BLASTX nr result
ID: Cinnamomum23_contig00042192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00042192 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278685.1| PREDICTED: transcription factor CPC-like [Ne... 67 6e-09 ref|XP_010657318.1| PREDICTED: MYB-like transcription factor ETC... 66 8e-09 ref|XP_007045608.1| Homeodomain-like superfamily protein [Theobr... 66 8e-09 emb|CBI28950.3| unnamed protein product [Vitis vinifera] 66 8e-09 ref|XP_012086360.1| PREDICTED: MYB-like transcription factor ETC... 66 1e-08 ref|XP_002317211.1| hypothetical protein POPTR_0011s00390g [Popu... 65 1e-08 ref|XP_006383940.1| hypothetical protein POPTR_0004s02060g [Popu... 65 1e-08 ref|XP_002529738.1| triptychon and cpc, putative [Ricinus commun... 65 2e-08 ref|XP_008379624.1| PREDICTED: transcription factor CPC-like [Ma... 65 2e-08 ref|XP_012438425.1| PREDICTED: uncharacterized protein LOC105764... 64 3e-08 gb|KHG02905.1| Transcription factor CPC -like protein [Gossypium... 64 3e-08 ref|XP_008806410.1| PREDICTED: transcription factor CPC-like iso... 64 3e-08 ref|XP_008806409.1| PREDICTED: transcription factor CPC-like iso... 64 3e-08 ref|XP_002267669.1| PREDICTED: MYB-like transcription factor ETC... 64 3e-08 emb|CAN76121.1| hypothetical protein VITISV_033885 [Vitis vinifera] 64 3e-08 ref|XP_011037720.1| PREDICTED: MYB-like transcription factor ETC... 64 4e-08 ref|XP_010923911.1| PREDICTED: transcription factor CPC-like [El... 64 4e-08 ref|XP_010248700.1| PREDICTED: transcription factor TRY-like [Ne... 64 4e-08 ref|XP_010051096.1| PREDICTED: MYB-like transcription factor ETC... 64 4e-08 ref|XP_012091404.1| PREDICTED: MYB-like transcription factor ETC... 64 4e-08 >ref|XP_010278685.1| PREDICTED: transcription factor CPC-like [Nelumbo nucifera] Length = 76 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 26 KLEFSEDEETLISRMFNLVGERWSLIAGRIPGRT 59 >ref|XP_010657318.1| PREDICTED: MYB-like transcription factor ETC3 [Vitis vinifera] Length = 96 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 47 KLEFSEDEETLITRMFNLVGERWSLIAGRIPGRT 80 >ref|XP_007045608.1| Homeodomain-like superfamily protein [Theobroma cacao] gi|508709543|gb|EOY01440.1| Homeodomain-like superfamily protein [Theobroma cacao] Length = 73 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 24 KLEFSEDEETLITRMFNLVGERWSLIAGRIPGRT 57 >emb|CBI28950.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 24 KLEFSEDEETLITRMFNLVGERWSLIAGRIPGRT 57 >ref|XP_012086360.1| PREDICTED: MYB-like transcription factor ETC1 [Jatropha curcas] gi|643712610|gb|KDP25849.1| hypothetical protein JCGZ_22879 [Jatropha curcas] Length = 75 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 26 KPEFSEDEETLIVRMFNLVGERWSLIAGRIPGRT 59 >ref|XP_002317211.1| hypothetical protein POPTR_0011s00390g [Populus trichocarpa] gi|222860276|gb|EEE97823.1| hypothetical protein POPTR_0011s00390g [Populus trichocarpa] Length = 74 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 25 KLEFSEDEETLIIRMFNLVGERWSLIAGRIPGRT 58 >ref|XP_006383940.1| hypothetical protein POPTR_0004s02060g [Populus trichocarpa] gi|550340123|gb|ERP61737.1| hypothetical protein POPTR_0004s02060g [Populus trichocarpa] Length = 74 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 25 KLEFSEDEETLIIRMFNLVGERWSLIAGRIPGRT 58 >ref|XP_002529738.1| triptychon and cpc, putative [Ricinus communis] gi|223530779|gb|EEF32645.1| triptychon and cpc, putative [Ricinus communis] Length = 74 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K +FSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 25 KLDFSEDEETLITRMFNLVGERWSLIAGRIPGRT 58 >ref|XP_008379624.1| PREDICTED: transcription factor CPC-like [Malus domestica] gi|694324486|ref|XP_009353259.1| PREDICTED: transcription factor CPC-like [Pyrus x bretschneideri] Length = 76 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERWSLIAGRIPGR+ Sbjct: 27 KLEFSEDEETLITRMFNLVGERWSLIAGRIPGRS 60 >ref|XP_012438425.1| PREDICTED: uncharacterized protein LOC105764416 [Gossypium raimondii] gi|763782259|gb|KJB49330.1| hypothetical protein B456_008G172400 [Gossypium raimondii] gi|763782260|gb|KJB49331.1| hypothetical protein B456_008G172400 [Gossypium raimondii] Length = 132 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K +FSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 77 KLDFSEDEETLIIRMFNLVGERWSLIAGRIPGRT 110 >gb|KHG02905.1| Transcription factor CPC -like protein [Gossypium arboreum] Length = 91 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K +FSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 20 KLDFSEDEETLIIRMFNLVGERWSLIAGRIPGRT 53 >ref|XP_008806410.1| PREDICTED: transcription factor CPC-like isoform X2 [Phoenix dactylifera] Length = 73 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EF+EDEETLI RM+NLLG+RWSLIAGRIPGRT Sbjct: 23 KVEFTEDEETLIARMYNLLGDRWSLIAGRIPGRT 56 >ref|XP_008806409.1| PREDICTED: transcription factor CPC-like isoform X1 [Phoenix dactylifera] Length = 74 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EF+EDEETLI RM+NLLG+RWSLIAGRIPGRT Sbjct: 24 KVEFTEDEETLIARMYNLLGDRWSLIAGRIPGRT 57 >ref|XP_002267669.1| PREDICTED: MYB-like transcription factor ETC1 [Vitis vinifera] gi|302144068|emb|CBI23173.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERW+LIAGRIPGRT Sbjct: 26 KLEFSEDEETLIIRMFNLVGERWALIAGRIPGRT 59 >emb|CAN76121.1| hypothetical protein VITISV_033885 [Vitis vinifera] Length = 189 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMFNL+GERW+LIAGRIPGRT Sbjct: 71 KLEFSEDEETLIIRMFNLVGERWALIAGRIPGRT 104 >ref|XP_011037720.1| PREDICTED: MYB-like transcription factor ETC1 [Populus euphratica] Length = 74 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 97 EFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 EFSEDEETLI RMFNL+GERWSLIAGRIPGRT Sbjct: 27 EFSEDEETLIIRMFNLVGERWSLIAGRIPGRT 58 >ref|XP_010923911.1| PREDICTED: transcription factor CPC-like [Elaeis guineensis] Length = 74 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EF+EDEETLI RM+NLLG+RWSLIAGRIPGRT Sbjct: 24 KMEFTEDEETLIARMYNLLGDRWSLIAGRIPGRT 57 >ref|XP_010248700.1| PREDICTED: transcription factor TRY-like [Nelumbo nucifera] Length = 114 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EF+EDEETLI RM+NLLG+RWSLIAGRIPGRT Sbjct: 65 KLEFTEDEETLIARMYNLLGDRWSLIAGRIPGRT 98 >ref|XP_010051096.1| PREDICTED: MYB-like transcription factor ETC1 isoform X2 [Eucalyptus grandis] Length = 74 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 K EFSEDEETLI RMF L+GERWSLIAGRIPGRT Sbjct: 24 KLEFSEDEETLITRMFKLVGERWSLIAGRIPGRT 57 >ref|XP_012091404.1| PREDICTED: MYB-like transcription factor ETC1 [Jatropha curcas] gi|643703727|gb|KDP20791.1| hypothetical protein JCGZ_21262 [Jatropha curcas] Length = 74 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 103 KAEFSEDEETLIERMFNLLGERWSLIAGRIPGRT 2 KAEFSEDEE L+ RM+NL+GERWSLIAGRIPGRT Sbjct: 25 KAEFSEDEEALVIRMYNLVGERWSLIAGRIPGRT 58