BLASTX nr result
ID: Cinnamomum23_contig00042075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00042075 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011659682.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_006853643.2| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 gb|KJB56814.1| hypothetical protein B456_009G136800 [Gossypium r... 57 5e-06 gb|KJB56813.1| hypothetical protein B456_009G136800 [Gossypium r... 57 5e-06 ref|XP_011013041.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_011046759.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 gb|AIV98137.1| class III HD-Zip protein HDZ4 [Cunninghamia lance... 57 5e-06 gb|KHN39244.1| Homeobox-leucine zipper protein ATHB-15 [Glycine ... 57 5e-06 gb|KHN39243.1| Homeobox-leucine zipper protein ATHB-15 [Glycine ... 57 5e-06 gb|KHN05341.1| Homeobox-leucine zipper protein ATHB-15 [Glycine ... 57 5e-06 ref|XP_002284003.2| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010545673.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010545669.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010535179.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_012443274.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010479714.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010462051.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010500807.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010267183.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 ref|XP_010249545.1| PREDICTED: homeobox-leucine zipper protein A... 57 5e-06 >ref|XP_011659682.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 isoform X1 [Cucumis sativus] Length = 840 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_006853643.2| PREDICTED: homeobox-leucine zipper protein ATHB-15 [Amborella trichopoda] Length = 842 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 40 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 75 >gb|KJB56814.1| hypothetical protein B456_009G136800 [Gossypium raimondii] Length = 842 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >gb|KJB56813.1| hypothetical protein B456_009G136800 [Gossypium raimondii] Length = 726 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_011013041.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform X1 [Populus euphratica] Length = 838 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_011046759.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 [Populus euphratica] Length = 838 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 40 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 75 >gb|AIV98137.1| class III HD-Zip protein HDZ4 [Cunninghamia lanceolata] Length = 841 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 38 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 73 >gb|KHN39244.1| Homeobox-leucine zipper protein ATHB-15 [Glycine soja] Length = 838 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >gb|KHN39243.1| Homeobox-leucine zipper protein ATHB-15 [Glycine soja] Length = 841 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >gb|KHN05341.1| Homeobox-leucine zipper protein ATHB-15 [Glycine soja] Length = 976 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 27 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 62 >ref|XP_002284003.2| PREDICTED: homeobox-leucine zipper protein ATHB-15 [Vitis vinifera] Length = 838 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_010545673.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 isoform X2 [Tarenaya hassleriana] Length = 838 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_010545669.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 isoform X1 [Tarenaya hassleriana] gi|729357753|ref|XP_010545670.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 isoform X1 [Tarenaya hassleriana] gi|729357756|ref|XP_010545671.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 isoform X1 [Tarenaya hassleriana] gi|729357759|ref|XP_010545672.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 isoform X1 [Tarenaya hassleriana] Length = 839 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_010535179.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Tarenaya hassleriana] Length = 837 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 37 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 72 >ref|XP_012443274.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 [Gossypium raimondii] gi|728835383|gb|KHG14826.1| Homeobox-leucine zipper ATHB-15 -like protein [Gossypium arboreum] gi|763789816|gb|KJB56812.1| hypothetical protein B456_009G136800 [Gossypium raimondii] Length = 838 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 39 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 74 >ref|XP_010479714.1| PREDICTED: homeobox-leucine zipper protein ATHB-15 [Camelina sativa] Length = 835 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 38 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 73 >ref|XP_010462051.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform X1 [Camelina sativa] Length = 835 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 38 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 73 >ref|XP_010500807.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Camelina sativa] Length = 835 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 38 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 73 >ref|XP_010267183.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Nelumbo nucifera] gi|720035937|ref|XP_010267184.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Nelumbo nucifera] Length = 840 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 41 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 76 >ref|XP_010249545.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform X2 [Nelumbo nucifera] Length = 840 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 180 PSSIRR*ELIRECLILSNIEPKHIKVWF*NRR*KKK 73 PSSIRR +LIREC ILSNIEPK IKVWF NRR ++K Sbjct: 41 PSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREK 76