BLASTX nr result
ID: Cinnamomum23_contig00042033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00042033 (234 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075891.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_011084572.1| PREDICTED: two-component response regulator-... 61 3e-07 >ref|XP_011075891.1| PREDICTED: two-component response regulator-like APRR9 [Sesamum indicum] Length = 707 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/91 (38%), Positives = 47/91 (51%), Gaps = 20/91 (21%) Frame = -3 Query: 217 YPEQKVASLPIPVRGLRFETLGNACGSVISPMY--------------------CPQVRPF 98 Y + + S PIPVRG+RFE + GSV+ P Y P++ PF Sbjct: 486 YSQNREISHPIPVRGVRFENILKDYGSVVPPTYRAQSGQSPLPSPGAAHHSESLPRLNPF 545 Query: 97 YPLNDHTGASQQFRELMDQRINDATDQANNK 5 Y + +SQQF LMDQRI++A DQ +NK Sbjct: 546 YSSDCQPSSSQQFHNLMDQRISNAIDQTDNK 576 >ref|XP_011084572.1| PREDICTED: two-component response regulator-like APRR5 [Sesamum indicum] Length = 696 Score = 60.8 bits (146), Expect = 3e-07 Identities = 36/93 (38%), Positives = 49/93 (52%), Gaps = 20/93 (21%) Frame = -3 Query: 220 PYPEQKVASLPIPVRGLRFETLGNACGSVISPMYCPQVRP-------------------- 101 P+P+Q+ PIPVRGLRFE + N GS++ +Y Q P Sbjct: 475 PHPQQREIFQPIPVRGLRFENIINGFGSLMPQLYYDQSAPSSLPSPGTPNHSPSFTQLNA 534 Query: 100 FYPLNDHTGASQQFRELMDQRINDATDQANNKQ 2 FYP + +SQQF + DQRI++A DQA+ KQ Sbjct: 535 FYPSDHRPSSSQQFHRI-DQRISNAIDQADKKQ 566