BLASTX nr result
ID: Cinnamomum23_contig00041686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041686 (374 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005649828.1| GTP binding protein [Coccomyxa subellipsoide... 86 1e-14 ref|XP_005850168.1| hypothetical protein CHLNCDRAFT_57128 [Chlor... 85 2e-14 ref|XP_002958623.1| elongation factor Tu-like protein [Volvox ca... 82 1e-13 ref|XP_001697431.1| GTP binding protein [Chlamydomonas reinhardt... 82 1e-13 ref|XP_011396145.1| GTP-binding protein 1 [Auxenochlorella proto... 74 3e-11 gb|KKY16081.1| putative elongation factor tu gtp binding domain-... 65 1e-08 gb|KKF94074.1| GTP-binding protein 1 [Ceratocystis platani] 65 1e-08 dbj|GAM90632.1| hypothetical protein ANO11243_086770 [fungal sp.... 65 1e-08 ref|XP_007588318.1| putative gtp-binding protein [Neofusicoccum ... 65 1e-08 gb|EKG20658.1| HR1 repeat rho-binding protein [Macrophomina phas... 65 1e-08 ref|XP_009153176.1| elongation factor EF-1 alpha subunit [Exophi... 65 2e-08 ref|XP_003067246.1| elongation factor, putative [Coccidioides po... 65 2e-08 gb|KFH48534.1| GTP-binding protein-like protein [Acremonium chry... 65 2e-08 ref|XP_003345196.1| hypothetical protein SMAC_07872 [Sordaria ma... 64 3e-08 ref|XP_008713013.1| hypothetical protein HMPREF1541_10120 [Cyphe... 64 3e-08 gb|KJY00796.1| GTP-binding protein 1 [Zymoseptoria brevis] 64 4e-08 gb|KIN05038.1| hypothetical protein OIDMADRAFT_177369 [Oidiodend... 64 4e-08 gb|KFZ23830.1| hypothetical protein V502_01696 [Pseudogymnoascus... 64 4e-08 gb|KFZ12646.1| hypothetical protein V501_04119 [Pseudogymnoascus... 64 4e-08 gb|KFY99298.1| hypothetical protein V500_01403 [Pseudogymnoascus... 64 4e-08 >ref|XP_005649828.1| GTP binding protein [Coccomyxa subellipsoidea C-169] gi|384251807|gb|EIE25284.1| GTP binding protein [Coccomyxa subellipsoidea C-169] Length = 462 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGL 247 LRSGDRACVRFRFLQRPEYLT GTRFVFREGRTKGIGMVMG+ Sbjct: 421 LRSGDRACVRFRFLQRPEYLTPGTRFVFREGRTKGIGMVMGI 462 >ref|XP_005850168.1| hypothetical protein CHLNCDRAFT_57128 [Chlorella variabilis] gi|307109829|gb|EFN58066.1| hypothetical protein CHLNCDRAFT_57128 [Chlorella variabilis] Length = 471 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 LRSGDRACVRFRFLQRPEYLT GTRFVFREGRTKGIGMV+G P Sbjct: 420 LRSGDRACVRFRFLQRPEYLTPGTRFVFREGRTKGIGMVVGTEMSP 465 >ref|XP_002958623.1| elongation factor Tu-like protein [Volvox carteri f. nagariensis] gi|300256012|gb|EFJ40289.1| elongation factor Tu-like protein [Volvox carteri f. nagariensis] Length = 467 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGPM*KT 223 LRSGDRACVRFRF+QRPEY+T GTRFVFREGRTKGIG+V+G P +T Sbjct: 358 LRSGDRACVRFRFIQRPEYVTTGTRFVFREGRTKGIGIVVGTEHQPADRT 407 >ref|XP_001697431.1| GTP binding protein [Chlamydomonas reinhardtii] gi|158274310|gb|EDP00093.1| GTP binding protein, partial [Chlamydomonas reinhardtii] Length = 405 Score = 82.0 bits (201), Expect = 1e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 LRSGDRACVRFRF+QRPEY+T+GTRFVFREGRTKGIG+V+G P Sbjct: 358 LRSGDRACVRFRFIQRPEYVTSGTRFVFREGRTKGIGIVVGTEHQP 403 >ref|XP_011396145.1| GTP-binding protein 1 [Auxenochlorella protothecoides] gi|675350835|gb|KFM23275.1| GTP-binding protein 1 [Auxenochlorella protothecoides] Length = 471 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAE 241 LRSGDRA VRFRFLQ PEYLT G RFVFREG+TKG+G V+G A+ Sbjct: 423 LRSGDRATVRFRFLQHPEYLTPGARFVFREGKTKGVGRVVGFAD 466 >gb|KKY16081.1| putative elongation factor tu gtp binding domain-containing protein [Diplodia seriata] Length = 642 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYLT G R +FREGRTKG+G+V + P Sbjct: 576 IRTGDRATVAFRFVQRPEYLTVGERILFREGRTKGLGIVKAVGYDP 621 >gb|KKF94074.1| GTP-binding protein 1 [Ceratocystis platani] Length = 647 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEY+T GT F+FREGRTKG+G++ + P Sbjct: 554 IRTGDRALVAFRFVQRPEYITVGTPFLFREGRTKGLGIIKEVGYDP 599 >dbj|GAM90632.1| hypothetical protein ANO11243_086770 [fungal sp. No.11243] Length = 659 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPE+L G R +FREGRTKG+G+V GL P Sbjct: 585 IRTGDRATVAFRFVQRPEFLAVGDRILFREGRTKGLGIVKGLGYDP 630 >ref|XP_007588318.1| putative gtp-binding protein [Neofusicoccum parvum UCRNP2] gi|485917188|gb|EOD44232.1| putative gtp-binding protein [Neofusicoccum parvum UCRNP2] Length = 578 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYLT G R +FREGRTKG+G+V + P Sbjct: 512 IRTGDRATVAFRFVQRPEYLTVGERILFREGRTKGLGIVKAVGYDP 557 >gb|EKG20658.1| HR1 repeat rho-binding protein [Macrophomina phaseolina MS6] Length = 625 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYLT G R +FREGRTKG+G+V + P Sbjct: 559 IRTGDRATVAFRFVQRPEYLTVGERILFREGRTKGLGIVKAVGYDP 604 >ref|XP_009153176.1| elongation factor EF-1 alpha subunit [Exophiala dermatitidis NIH/UT8656] gi|378726256|gb|EHY52715.1| elongation factor EF-1 alpha subunit [Exophiala dermatitidis NIH/UT8656] Length = 655 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/51 (60%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMV--MGLAEGPM*K 226 +R+GDRA V FRF+QRPE+LT G R +FREGRTKG+G+V +G EG + K Sbjct: 564 IRTGDRATVAFRFVQRPEFLTVGERILFREGRTKGLGIVKALGFEEGSLSK 614 >ref|XP_003067246.1| elongation factor, putative [Coccidioides posadasii C735 delta SOWgp] gi|240106914|gb|EER25101.1| elongation factor, putative [Coccidioides posadasii C735 delta SOWgp] gi|320037540|gb|EFW19477.1| GTP-binding protein [Coccidioides posadasii str. Silveira] gi|855537621|gb|KMM71938.1| GTP-binding protein 1 [Coccidioides posadasii RMSCC 3488] Length = 633 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPE+L+ G R +FREGRTKG+G+V G+ P Sbjct: 569 IRTGDRATVAFRFIQRPEFLSVGDRILFREGRTKGLGIVKGVGYDP 614 >gb|KFH48534.1| GTP-binding protein-like protein [Acremonium chrysogenum ATCC 11550] Length = 615 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYL AG R +FREGRT+G+G+V + P Sbjct: 557 IRTGDRALVAFRFVQRPEYLVAGDRLIFREGRTRGLGIVKSVGYDP 602 >ref|XP_003345196.1| hypothetical protein SMAC_07872 [Sordaria macrospora k-hell] gi|380088007|emb|CCC05134.1| unnamed protein product [Sordaria macrospora k-hell] Length = 654 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYL G R +FREGRTKG+G+V L P Sbjct: 579 IRTGDRATVAFRFVQRPEYLVPGDRLLFREGRTKGLGIVKSLGYDP 624 >ref|XP_008713013.1| hypothetical protein HMPREF1541_10120 [Cyphellophora europaea CBS 101466] gi|568122650|gb|ETN45243.1| hypothetical protein HMPREF1541_10120 [Cyphellophora europaea CBS 101466] Length = 668 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMV--MGLAEGPM*K 226 +R+GDRA V FRF+QRPEYL G R +FREGRTKG+G+V +G EG + K Sbjct: 568 IRTGDRATVAFRFVQRPEYLNIGDRILFREGRTKGLGIVKSLGFEEGSLGK 618 >gb|KJY00796.1| GTP-binding protein 1 [Zymoseptoria brevis] Length = 657 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYL+ G R +FREGRTKG+G+V + P Sbjct: 578 IRTGDRATVAFRFVQRPEYLSVGERILFREGRTKGLGIVKAVGYDP 623 >gb|KIN05038.1| hypothetical protein OIDMADRAFT_177369 [Oidiodendron maius Zn] Length = 630 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGP 235 +R+GDRA V FRF+QRPEYL G R +FREGRTKG+G+V + P Sbjct: 550 IRTGDRAVVAFRFIQRPEYLAVGDRLLFREGRTKGLGIVKSVGYDP 595 >gb|KFZ23830.1| hypothetical protein V502_01696 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 639 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGPM 232 +R+GDRA V FRF+QRPEYL G R +FREGRTKG+G+V + P+ Sbjct: 549 IRTGDRALVAFRFVQRPEYLVPGDRLLFREGRTKGLGIVKSVGYDPL 595 >gb|KFZ12646.1| hypothetical protein V501_04119 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 643 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGPM 232 +R+GDRA V FRF+QRPEYL G R +FREGRTKG+G+V + P+ Sbjct: 549 IRTGDRATVAFRFVQRPEYLVPGDRLLFREGRTKGLGIVKSVGYDPL 595 >gb|KFY99298.1| hypothetical protein V500_01403 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] Length = 639 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 372 LRSGDRACVRFRFLQRPEYLTAGTRFVFREGRTKGIGMVMGLAEGPM 232 +R+GDRA V FRF+QRPEYL G R +FREGRTKG+G+V + P+ Sbjct: 549 IRTGDRALVAFRFVQRPEYLVPGDRLLFREGRTKGLGIVKSVGYDPL 595