BLASTX nr result
ID: Cinnamomum23_contig00041586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041586 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane prot... 80 5e-13 ref|XP_012841390.1| PREDICTED: mitochondrial outer membrane prot... 80 7e-13 ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane prot... 79 9e-13 ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane prot... 78 3e-12 ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane prot... 76 1e-11 ref|NP_001275154.1| mitochondrial outer membrane protein porin o... 76 1e-11 ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane prot... 75 1e-11 gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea] 75 1e-11 ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane prot... 75 1e-11 emb|CDP02196.1| unnamed protein product [Coffea canephora] 74 3e-11 gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin... 74 3e-11 gb|ABB02635.1| unknown [Solanum tuberosum] 74 3e-11 ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Sol... 74 3e-11 ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane prot... 74 3e-11 gb|ABI73982.1| voltage-dependent anion-selective channel protein... 74 3e-11 gb|AAB38498.1| porin [Mesembryanthemum crystallinum] 74 4e-11 ref|XP_012840472.1| PREDICTED: mitochondrial outer membrane prot... 73 9e-11 gb|EYU34672.1| hypothetical protein MIMGU_mgv1a021682mg, partial... 73 9e-11 ref|XP_012840637.1| PREDICTED: mitochondrial outer membrane prot... 73 9e-11 ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane prot... 72 1e-10 >ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Sesamum indicum] Length = 276 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+AL+QHEWRPKSL+TVSTEV+TKSIDKSAKFG+AL LKP Sbjct: 234 FGKASALIQHEWRPKSLITVSTEVDTKSIDKSAKFGVALALKP 276 >ref|XP_012841390.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Erythranthe guttatus] gi|604328554|gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata] Length = 276 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+AL+QHEWRPKSLVTVS+EV+TKS+DKSAKFGLAL LKP Sbjct: 234 FGKASALIQHEWRPKSLVTVSSEVDTKSVDKSAKFGLALALKP 276 >ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Sesamum indicum] Length = 276 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA AL+QHEWRPKSL+TVSTEV+TKSIDKSAKFG AL LKP Sbjct: 234 FGKANALIQHEWRPKSLITVSTEVDTKSIDKSAKFGFALALKP 276 >ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Sesamum indicum] Length = 276 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+AL+QHEWRPKSL+TVSTEV+TKSIDKS KFG AL LKP Sbjct: 234 FGKASALIQHEWRPKSLITVSTEVDTKSIDKSPKFGFALALKP 276 >ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Solanum lycopersicum] Length = 276 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+ALLQHEWRPKSL TVS EV+TKS+DK AKFGLAL LKP Sbjct: 234 FGKASALLQHEWRPKSLFTVSGEVDTKSVDKGAKFGLALALKP 276 >ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum tuberosum] gi|1172555|sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|516166|emb|CAA56599.1| 34 kDA porin [Solanum tuberosum] Length = 276 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+ALLQHEWRPKSL TVS EV+TKS+DK AKFGLAL LKP Sbjct: 234 FGKASALLQHEWRPKSLFTVSGEVDTKSVDKGAKFGLALALKP 276 >ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Nicotiana sylvestris] Length = 276 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+ALLQHEWRPKSL T+S EV+TKS+DK AKFGLAL LKP Sbjct: 234 FGKASALLQHEWRPKSLFTISGEVDTKSVDKGAKFGLALALKP 276 >gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea] Length = 276 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = -2 Query: 228 GKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 GKA+AL+QHEWRPKSL+T+STEV+T+S+DKSAKFGLAL LKP Sbjct: 235 GKASALIQHEWRPKSLLTLSTEVDTRSVDKSAKFGLALALKP 276 >ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Nicotiana tomentosiformis] gi|161788876|dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum] Length = 276 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKA+ALLQHEWRPKSL T+S EV+TKS+DK AKFGLAL LKP Sbjct: 234 FGKASALLQHEWRPKSLFTISGEVDTKSVDKGAKFGLALALKP 276 >emb|CDP02196.1| unnamed protein product [Coffea canephora] Length = 276 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 +GKA+AL+QHEWRPKSL T++ EV+TKSID+SAKFGLALVLKP Sbjct: 234 YGKASALIQHEWRPKSLFTITGEVDTKSIDQSAKFGLALVLKP 276 >gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein [Solanum tuberosum] Length = 276 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FG ATAL+QHEWRPKSL T+S EV+TK++DKSAKFGLAL LKP Sbjct: 234 FGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 276 >gb|ABB02635.1| unknown [Solanum tuberosum] Length = 171 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FG ATAL+QHEWRPKSL T+S EV+TK++DKSAKFGLAL LKP Sbjct: 129 FGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 171 >ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum] Length = 276 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FG ATAL+QHEWRPKSL T+S EV+TK++DKSAKFGLAL LKP Sbjct: 234 FGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 276 >ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Solanum lycopersicum] Length = 276 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FG ATAL+QHEWRPKSL T+S EV+TK++DKSAKFGLAL LKP Sbjct: 234 FGMATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 276 >gb|ABI73982.1| voltage-dependent anion-selective channel protein [Musa acuminata AAA Group] Length = 81 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FG ATAL+QHEWRPKSL T+S EV+TK++DKSAKFGLAL LKP Sbjct: 39 FGMATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 81 >gb|AAB38498.1| porin [Mesembryanthemum crystallinum] Length = 276 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 231 FGKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 FGKATAL+QHEWRPKSLVT S EV+TK+I+KSAK GLAL LKP Sbjct: 234 FGKATALIQHEWRPKSLVTFSAEVDTKAIEKSAKVGLALALKP 276 >ref|XP_012840472.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Erythranthe guttatus] Length = 115 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 228 GKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 GK +AL+QHEWRPKSL+TVSTEV+ K+ DKSAKFGLAL LKP Sbjct: 74 GKVSALIQHEWRPKSLITVSTEVDAKAFDKSAKFGLALALKP 115 >gb|EYU34672.1| hypothetical protein MIMGU_mgv1a021682mg, partial [Erythranthe guttata] Length = 133 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 228 GKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 GK +AL+QHEWRPKSL+TVSTEV+ K+ DKSAKFGLAL LKP Sbjct: 92 GKVSALIQHEWRPKSLITVSTEVDAKAFDKSAKFGLALALKP 133 >ref|XP_012840637.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Erythranthe guttatus] gi|604329338|gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata] Length = 276 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 228 GKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 GK +AL+QHEWRPKSL+TVSTEV+ K+ DKSAKFGLAL LKP Sbjct: 235 GKVSALIQHEWRPKSLITVSTEVDAKAFDKSAKFGLALALKP 276 >ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Nicotiana sylvestris] Length = 276 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 228 GKATALLQHEWRPKSLVTVSTEVNTKSIDKSAKFGLALVLKP 103 GKA AL+QHEWRPKSL T+S EV+TK++DKSAKFGLAL LKP Sbjct: 235 GKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP 276