BLASTX nr result
ID: Cinnamomum23_contig00041532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041532 (455 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010103611.1| hypothetical protein L484_023108 [Morus nota... 58 3e-06 >ref|XP_010103611.1| hypothetical protein L484_023108 [Morus notabilis] gi|587908435|gb|EXB96388.1| hypothetical protein L484_023108 [Morus notabilis] Length = 122 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -1 Query: 431 TSQFLGDIEFHRLMYTNHQTGRWCDPQAEKDYNDMLAPRDSQSQNSDV 288 T+QF+GDIEF+ +MYTNH+T +WC+PQ E+DY +QS+N +V Sbjct: 3 TNQFIGDIEFYWVMYTNHKTKQWCNPQGEQDYFSC----GAQSENDEV 46