BLASTX nr result
ID: Cinnamomum23_contig00041426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041426 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010912852.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_008808564.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 gb|ABL85051.1| hypothetical protein 57h21.26 [Brachypodium sylva... 63 9e-08 ref|XP_010924258.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 gb|EMT12171.1| hypothetical protein F775_17808 [Aegilops tauschii] 62 2e-07 ref|XP_012699756.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_008661058.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_011000454.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 60 6e-07 ref|XP_002322628.1| pentatricopeptide repeat-containing family p... 60 6e-07 ref|XP_010248558.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_008441965.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_010229982.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008364513.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008346536.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 1e-06 ref|XP_008373752.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008373707.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 dbj|BAA83584.1| pentatricopeptide (PPR) repeat-containing protei... 59 1e-06 ref|XP_009339406.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 emb|CDP21013.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP21130.1| unnamed protein product [Coffea canephora] 59 1e-06 >ref|XP_010912852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Elaeis guineensis] Length = 541 Score = 75.1 bits (183), Expect = 2e-11 Identities = 30/61 (49%), Positives = 48/61 (78%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKVKTL 89 L +VFD I +P+LATWNALI+ F +N ++ Y + F++MP +N++SW A++NGYI+VK + Sbjct: 113 LFRVFDDIVHPNLATWNALISGFAINRRISYAREAFDRMPRRNVVSWTAMINGYIEVKKV 172 Query: 88 K 86 + Sbjct: 173 R 173 >ref|XP_008808564.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Phoenix dactylifera] Length = 781 Score = 73.2 bits (178), Expect = 7e-11 Identities = 29/61 (47%), Positives = 46/61 (75%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKVKTL 89 L +VFD I P+LATWNALI+ F +N ++ Y + F++MP +N++SW A++NGY +VK + Sbjct: 172 LIRVFDDIVRPNLATWNALISGFAINRRMNYAREAFDRMPRRNVVSWTAMINGYAEVKKV 231 Query: 88 K 86 + Sbjct: 232 R 232 >gb|ABL85051.1| hypothetical protein 57h21.26 [Brachypodium sylvaticum] Length = 753 Score = 62.8 bits (151), Expect = 9e-08 Identities = 24/57 (42%), Positives = 44/57 (77%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKV 98 L +VFD +++P++A WNAL++ V+N ++ +VFN+MP++N++SW A+V G++ V Sbjct: 145 LERVFDDVDSPNVALWNALVSGLVMNHRVGDARRVFNRMPARNVVSWTAMVKGHVSV 201 >ref|XP_010924258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Elaeis guineensis] Length = 599 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/53 (43%), Positives = 42/53 (79%) Frame = -1 Query: 259 VFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIK 101 VFD+I++PS++ W AL++ F GQLE ++F++MP +N++SW A+++GY++ Sbjct: 152 VFDSISDPSVSAWTALLSGFAKLGQLEVAREMFDRMPERNLVSWNAMISGYVQ 204 >gb|EMT12171.1| hypothetical protein F775_17808 [Aegilops tauschii] Length = 796 Score = 62.0 bits (149), Expect = 2e-07 Identities = 24/57 (42%), Positives = 42/57 (73%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKV 98 L +VFD ++ P++A WNAL++ V+N ++ +VF++MP +N++SW A+V GY+ V Sbjct: 188 LQRVFDDVDTPNVALWNALLSGLVMNHRVADARRVFDEMPGRNVVSWTAMVKGYVTV 244 >ref|XP_012699756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 isoform X1 [Setaria italica] Length = 761 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/60 (41%), Positives = 45/60 (75%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKVKTL 89 L +V +A+++P++A WNALI+ V+N ++E +VF++M +N++SW A+V GY++V L Sbjct: 153 LERVVNAVDSPNVALWNALISGLVMNHRVEDARRVFDKMTERNVVSWTAMVKGYVRVHEL 212 >ref|XP_008661058.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Zea mays] Length = 433 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKV 98 L + D +++P+LA WNALI+ VVN ++E +VF+QMP N++SW ++ GY V Sbjct: 128 LEWIVDDVDSPNLALWNALISGLVVNHRVEDARRVFDQMPEHNVVSWTVMIKGYFTV 184 >ref|XP_011000454.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g35030, mitochondrial [Populus euphratica] Length = 631 Score = 60.1 bits (144), Expect = 6e-07 Identities = 20/53 (37%), Positives = 39/53 (73%) Frame = -1 Query: 259 VFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIK 101 +F+ + +L++WN +IT F+ NG+L + +VFN+MP +N++SW ++ GY++ Sbjct: 255 LFERMPERNLSSWNTMITGFIQNGELAWARKVFNEMPEKNVVSWTTMITGYVQ 307 >ref|XP_002322628.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222867258|gb|EEF04389.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 559 Score = 60.1 bits (144), Expect = 6e-07 Identities = 20/53 (37%), Positives = 39/53 (73%) Frame = -1 Query: 259 VFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIK 101 +F+ + +L++WN +IT F+ NG+L + +VFN+MP +N++SW ++ GY++ Sbjct: 184 LFERMPERNLSSWNTMITGFIQNGELAWARKVFNEMPEKNVVSWTTMITGYVQ 236 >ref|XP_010248558.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Nelumbo nucifera] Length = 779 Score = 59.7 bits (143), Expect = 7e-07 Identities = 22/54 (40%), Positives = 40/54 (74%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIK 101 Q FD+I++ +L +WN+++ + +NGQLE ++F Q+P +NI+SW +V GY++ Sbjct: 418 QAFDSISDRNLVSWNSMVAGYSLNGQLEEAKELFEQIPKRNIVSWNTIVAGYVQ 471 >ref|XP_008441965.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial [Cucumis melo] Length = 495 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKV 98 +VFD + + S TWN LIT V G+L +VF+QMP QN++SW A+++GY ++ Sbjct: 171 KVFDEMPDRSSVTWNVLITGLVKLGELRRAREVFDQMPMQNVVSWTAIIDGYTRL 225 >ref|XP_010229982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Brachypodium distachyon] Length = 760 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/57 (42%), Positives = 42/57 (73%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKV 98 L QVF +++P++ WNAL++ V+N ++ VF++MP++NI+SW A+V G++KV Sbjct: 152 LEQVFGDVDSPNVVLWNALVSGLVMNHRVGDARGVFDRMPARNIVSWTAMVKGHVKV 208 >ref|XP_008364513.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Malus domestica] Length = 402 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/52 (42%), Positives = 39/52 (75%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGY 107 Q+FDA+ ++ +WN+++ + NG LE QVF+QMP++N++SW A+++GY Sbjct: 162 QLFDAMPERNVVSWNSMMAGLIKNGDLEGARQVFDQMPTKNVVSWNAMISGY 213 >ref|XP_008346536.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Malus domestica] Length = 611 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/52 (42%), Positives = 39/52 (75%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGY 107 Q+FDA+ ++ +WN+++ + NG LE QVF+QMP++N++SW A+++GY Sbjct: 162 QLFDAMPERNVVSWNSMMAGLIKNGDLEGARQVFDQMPTKNVVSWNAMISGY 213 >ref|XP_008373752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial, partial [Malus domestica] Length = 707 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/52 (42%), Positives = 39/52 (75%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGY 107 Q+FDA+ ++ +WN+++ + NG LE QVF+QMP++N++SW A+++GY Sbjct: 125 QLFDAMPERNVVSWNSMMAGLIKNGDLEGARQVFDQMPTKNVVSWNAMISGY 176 >ref|XP_008373707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like, partial [Malus domestica] Length = 390 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/52 (42%), Positives = 39/52 (75%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGY 107 Q+FDA+ ++ +WN+++ + NG LE QVF+QMP++N++SW A+++GY Sbjct: 162 QLFDAMPERNVVSWNSMMAGLIKNGDLEGARQVFDQMPTKNVVSWNAMISGY 213 >dbj|BAA83584.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|55296350|dbj|BAD68395.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|125596022|gb|EAZ35802.1| hypothetical protein OsJ_20095 [Oryza sativa Japonica Group] Length = 763 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/54 (40%), Positives = 39/54 (72%) Frame = -1 Query: 268 LTQVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGY 107 L QV D + +P++A WNALI+ V+N ++ Y + F++MP +N++SW A++ G+ Sbjct: 155 LEQVLDGVESPNVALWNALISGLVMNHRVGYARKAFDRMPVRNVVSWTAMIKGH 208 >ref|XP_009339406.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Pyrus x bretschneideri] Length = 745 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/52 (44%), Positives = 39/52 (75%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGY 107 Q+FDA+ ++ +WN++I + NG LE QVF+QMP++N++SW A+++GY Sbjct: 162 QLFDAMPERNVFSWNSMIAGLIKNGDLEGAGQVFDQMPTKNVVSWNAMISGY 213 >emb|CDP21013.1| unnamed protein product [Coffea canephora] Length = 478 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/56 (41%), Positives = 38/56 (67%) Frame = -1 Query: 262 QVFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIKVK 95 +VFD + +L TWNAL+T F+ G L VFN+MP +N++SW +++GY +++ Sbjct: 154 KVFDEMPQKNLVTWNALLTGFIRWGDLGSAQSVFNRMPQKNVVSWTGMIDGYTRMR 209 >emb|CDP21130.1| unnamed protein product [Coffea canephora] Length = 348 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = -1 Query: 259 VFDAINNPSLATWNALITRFVVNGQLEYTHQVFNQMPSQNIISWIALVNGYIK 101 +FD + N +LA+WNA+I+ FV G L ++FN+MP +N IS+ ++NGY+K Sbjct: 17 LFDEMTNRNLASWNAMISGFVRFGDLRSARELFNEMPEKNAISYTTMINGYVK 69