BLASTX nr result
ID: Cinnamomum23_contig00041411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041411 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010254352.1| PREDICTED: uncharacterized protein LOC104595... 58 3e-06 >ref|XP_010254352.1| PREDICTED: uncharacterized protein LOC104595348 [Nelumbo nucifera] Length = 445 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = -2 Query: 172 NLQFGLKLLMMKHIRPQRFNAVFYHHLVELDDEPPSLEWYERAYPKLVKLTQILKNV 2 +L +G K L KH P+ N + YH E ++E PS EWY+ A+PKL KL+ +L+NV Sbjct: 29 SLFYGPKQLKAKHFGPRHLNVLLYHCSEEFNEELPSSEWYKTAFPKLNKLSHVLRNV 85