BLASTX nr result
ID: Cinnamomum23_contig00041313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041313 (295 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088127.1| hypothetical protein L484_013571 [Morus nota... 89 2e-15 ref|XP_010272376.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-15 ref|XP_007217215.1| hypothetical protein PRUPE_ppa004696mg [Prun... 79 9e-13 ref|XP_008230801.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_004306129.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_012084737.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_002530005.1| pentatricopeptide repeat-containing protein,... 78 2e-12 ref|XP_008379384.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_002323875.2| hypothetical protein POPTR_0017s12280g [Popu... 77 5e-12 ref|XP_003551744.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_004502039.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_010029319.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 emb|CAN60969.1| hypothetical protein VITISV_033859 [Vitis vinifera] 73 7e-11 ref|XP_003601393.1| Pentatricopeptide repeat-containing protein ... 71 3e-10 ref|XP_010661087.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_007139542.1| hypothetical protein PHAVU_008G038800g [Phas... 69 1e-09 emb|CBI22251.3| unnamed protein product [Vitis vinifera] 68 3e-09 gb|KDP27177.1| hypothetical protein JCGZ_19876 [Jatropha curcas] 65 1e-08 gb|KGN62019.1| hypothetical protein Csa_2G286520 [Cucumis sativus] 65 2e-08 ref|XP_011659892.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 >ref|XP_010088127.1| hypothetical protein L484_013571 [Morus notabilis] gi|587841332|gb|EXB31939.1| hypothetical protein L484_013571 [Morus notabilis] Length = 119 Score = 88.6 bits (218), Expect = 2e-15 Identities = 44/80 (55%), Positives = 51/80 (63%) Frame = +2 Query: 56 DLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLF 235 +LV+ L S+++ C SMR+LK IH RFAAVSPSGDLHYAH LF Sbjct: 10 NLVAALASMAESCLSMRDLKQIHAHAIVANLHRHHVVLGKIFRFAAVSPSGDLHYAHQLF 69 Query: 236 SNTPHPDTFFYNTLIRGYAK 295 S P P TFFYNTLIRGY+K Sbjct: 70 SQMPQPRTFFYNTLIRGYSK 89 >ref|XP_010272376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Nelumbo nucifera] Length = 499 Score = 88.6 bits (218), Expect = 2e-15 Identities = 44/79 (55%), Positives = 52/79 (65%) Frame = +2 Query: 59 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFS 238 L + L S+++ CTSMR+LK IHGR RFAAVSPSGDLHYA +FS Sbjct: 15 LSTTLASMAESCTSMRDLKRIHGRTIRMGLHLHTLILAKMLRFAAVSPSGDLHYALRIFS 74 Query: 239 NTPHPDTFFYNTLIRGYAK 295 + P P+TFFYNTLIRGY K Sbjct: 75 HMPQPNTFFYNTLIRGYCK 93 >ref|XP_007217215.1| hypothetical protein PRUPE_ppa004696mg [Prunus persica] gi|462413365|gb|EMJ18414.1| hypothetical protein PRUPE_ppa004696mg [Prunus persica] Length = 495 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/72 (54%), Positives = 44/72 (61%) Frame = +2 Query: 80 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPHPDT 259 ++Q C SMR LK IH R RFAAVSPSGDL+YAH LF + P P T Sbjct: 20 MAQNCLSMRHLKQIHARSIVTNLHHHAIVFAKLFRFAAVSPSGDLNYAHRLFCHMPQPTT 79 Query: 260 FFYNTLIRGYAK 295 F YNTLIRGY+K Sbjct: 80 FLYNTLIRGYSK 91 >ref|XP_008230801.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Prunus mume] Length = 495 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/72 (54%), Positives = 43/72 (59%) Frame = +2 Query: 80 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPHPDT 259 ++Q C SMR LK IH R RFAAVSPSGDL+YAH LF P P T Sbjct: 20 MAQNCLSMRHLKQIHARSIVTNLHHHAIVFAKLFRFAAVSPSGDLNYAHRLFCQMPQPTT 79 Query: 260 FFYNTLIRGYAK 295 F YNTL+RGYAK Sbjct: 80 FLYNTLMRGYAK 91 >ref|XP_004306129.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Fragaria vesca subsp. vesca] Length = 487 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/79 (51%), Positives = 47/79 (59%) Frame = +2 Query: 59 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFS 238 L S L S++Q C SMR+LK IH R RFAAVSPSGDL+YAH LF Sbjct: 9 LSSRLASMAQTCLSMRQLKQIHARAILSNLHNHAVVLGKMFRFAAVSPSGDLNYAHQLFD 68 Query: 239 NTPHPDTFFYNTLIRGYAK 295 P TFFYN LIRG++K Sbjct: 69 QMLQPTTFFYNLLIRGHSK 87 >ref|XP_012084737.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Jatropha curcas] Length = 499 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/79 (49%), Positives = 45/79 (56%) Frame = +2 Query: 59 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFS 238 L + L S+++ C SM LK IH RFAAVSPSGDL YAH +F Sbjct: 15 LAATLASMAETCQSMNHLKQIHAHVILTNLHNNPIIFGKMLRFAAVSPSGDLPYAHRMFD 74 Query: 239 NTPHPDTFFYNTLIRGYAK 295 P P TFFYNT+IRGYAK Sbjct: 75 QMPQPKTFFYNTIIRGYAK 93 >ref|XP_002530005.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530484|gb|EEF32367.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 499 Score = 78.2 bits (191), Expect = 2e-12 Identities = 40/79 (50%), Positives = 45/79 (56%) Frame = +2 Query: 59 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFS 238 L S L S+++ C SM LK IH RFAAVSPSGDL YA LF Sbjct: 15 LASILASIAENCQSMNHLKQIHAHSLLTDLHNHSVILGKMLRFAAVSPSGDLPYAQRLFD 74 Query: 239 NTPHPDTFFYNTLIRGYAK 295 P P+TFFYNT+IRGYAK Sbjct: 75 QMPQPNTFFYNTIIRGYAK 93 >ref|XP_008379384.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Malus domestica] Length = 495 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/75 (50%), Positives = 44/75 (58%) Frame = +2 Query: 71 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPH 250 L ++Q C SM LK IHGR RFAA+SP+GDL YAH LF P Sbjct: 17 LAYMAQNCLSMTHLKQIHGRAVVTDLHHHAIVLAKMFRFAAISPAGDLSYAHRLFDQMPR 76 Query: 251 PDTFFYNTLIRGYAK 295 P+TFFYNTLIRG +K Sbjct: 77 PNTFFYNTLIRGXSK 91 >ref|XP_002323875.2| hypothetical protein POPTR_0017s12280g [Populus trichocarpa] gi|550320112|gb|EEF04008.2| hypothetical protein POPTR_0017s12280g [Populus trichocarpa] Length = 474 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/72 (52%), Positives = 42/72 (58%) Frame = +2 Query: 80 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPHPDT 259 +++ C SM LK IH RFAAVSPSGDL YA LF PHP+T Sbjct: 1 MAEACNSMSRLKQIHAHSLLAGLHDHSIILAKMLRFAAVSPSGDLAYAQRLFDQLPHPNT 60 Query: 260 FFYNTLIRGYAK 295 FFYNTLIRGYAK Sbjct: 61 FFYNTLIRGYAK 72 >ref|XP_003551744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Glycine max] Length = 488 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/74 (48%), Positives = 43/74 (58%) Frame = +2 Query: 71 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPH 250 L +++RCT MR+LK +H RFAAVSP GDL YAH +F PH Sbjct: 10 LAHMAERCTCMRDLKLLHAHAFRTRLHDHTVVLGKLFRFAAVSPLGDLRYAHRMFDQMPH 69 Query: 251 PDTFFYNTLIRGYA 292 P TFFYNTLIR +A Sbjct: 70 PTTFFYNTLIRAHA 83 >ref|XP_004502039.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Cicer arietinum] Length = 486 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/79 (45%), Positives = 45/79 (56%) Frame = +2 Query: 56 DLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLF 235 ++ S L+ +++RCTSMR LK IH RF AVSP GDL YAH +F Sbjct: 5 NVASTLVYMAERCTSMRYLKLIHAHAYRTCLHQHTVVLGKLFRFVAVSPFGDLSYAHNMF 64 Query: 236 SNTPHPDTFFYNTLIRGYA 292 PHP TFFYN LIR ++ Sbjct: 65 DQMPHPSTFFYNILIRAHS 83 >ref|XP_010029319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 [Eucalyptus grandis] gi|629089968|gb|KCW56221.1| hypothetical protein EUGRSUZ_I01971 [Eucalyptus grandis] Length = 496 Score = 73.2 bits (178), Expect = 7e-11 Identities = 39/78 (50%), Positives = 43/78 (55%) Frame = +2 Query: 59 LVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFS 238 L S L SL+ C SMR L IH R RFAAVSPSGDL YAH LF Sbjct: 20 LASALASLADTCLSMRGLTQIHARALRSHLHDHPLVLAKIFRFAAVSPSGDLLYAHRLFD 79 Query: 239 NTPHPDTFFYNTLIRGYA 292 P P+ FF+N LIRGY+ Sbjct: 80 QIPRPNAFFHNLLIRGYS 97 >emb|CAN60969.1| hypothetical protein VITISV_033859 [Vitis vinifera] Length = 722 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/75 (49%), Positives = 45/75 (60%) Frame = +2 Query: 71 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPH 250 L S+++ C +M+ LK IH R RFAAVSP+G LHYA LFS Sbjct: 90 LASMAEACLAMQALKLIHARAFRANLHNHALVLAKIFRFAAVSPNGCLHYADRLFSQIHQ 149 Query: 251 PDTFFYNTLIRGYAK 295 P+TFFYNTLIRGY+K Sbjct: 150 PNTFFYNTLIRGYSK 164 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/75 (49%), Positives = 45/75 (60%) Frame = +2 Query: 71 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPH 250 L S+++ C +M+ LK IH R RFAAVSP+G LHYA LFS Sbjct: 244 LASMAEACLAMQALKLIHARAFRANLHNHALVLAKIFRFAAVSPNGCLHYADRLFSQIHQ 303 Query: 251 PDTFFYNTLIRGYAK 295 P+TFFYNTLIRGY+K Sbjct: 304 PNTFFYNTLIRGYSK 318 >ref|XP_003601393.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|358344321|ref|XP_003636238.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355490441|gb|AES71644.1| PPR containing plant-like protein [Medicago truncatula] Length = 486 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/79 (43%), Positives = 44/79 (55%) Frame = +2 Query: 56 DLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLF 235 ++ S L+ ++++C SMR K IH RFAAVSP GDL YAH +F Sbjct: 5 NVASALVYMAEKCISMRNFKLIHAHAFRTCLHQHAVVLGKLFRFAAVSPFGDLSYAHNMF 64 Query: 236 SNTPHPDTFFYNTLIRGYA 292 P P TFFYNTLIR ++ Sbjct: 65 DQMPQPTTFFYNTLIRAHS 83 >ref|XP_010661087.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Vitis vinifera] Length = 488 Score = 70.5 bits (171), Expect = 4e-10 Identities = 36/75 (48%), Positives = 44/75 (58%) Frame = +2 Query: 71 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPH 250 L S+++ C +M+ LK IH RFAAVSP+G LHYA LFS Sbjct: 10 LASMAEACLTMQALKLIHALAFRANLHHHALVLAKIFRFAAVSPNGCLHYADRLFSQIHQ 69 Query: 251 PDTFFYNTLIRGYAK 295 P+TFFYNTLIRGY+K Sbjct: 70 PNTFFYNTLIRGYSK 84 >ref|XP_007139542.1| hypothetical protein PHAVU_008G038800g [Phaseolus vulgaris] gi|561012675|gb|ESW11536.1| hypothetical protein PHAVU_008G038800g [Phaseolus vulgaris] Length = 488 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/74 (45%), Positives = 41/74 (55%) Frame = +2 Query: 71 LLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPH 250 L ++QRCT M +LK +H RFAAVSP GDL YAH +F PH Sbjct: 10 LAHMAQRCTCMPDLKILHAHAFRMHLHDHVVVLGKLFRFAAVSPMGDLRYAHHMFDIMPH 69 Query: 251 PDTFFYNTLIRGYA 292 TFFYNTLIR ++ Sbjct: 70 RTTFFYNTLIRAHS 83 >emb|CBI22251.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/72 (47%), Positives = 42/72 (58%) Frame = +2 Query: 80 LSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHTLFSNTPHPDT 259 +++ C +M+ LK IH RFAAVSP+G LHYA LFS P+T Sbjct: 1 MAEACLTMQALKLIHALAFRANLHHHALVLAKIFRFAAVSPNGCLHYADRLFSQIHQPNT 60 Query: 260 FFYNTLIRGYAK 295 FFYNTLIRGY+K Sbjct: 61 FFYNTLIRGYSK 72 >gb|KDP27177.1| hypothetical protein JCGZ_19876 [Jatropha curcas] Length = 446 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +2 Query: 182 RFAAVSPSGDLHYAHTLFSNTPHPDTFFYNTLIRGYAK 295 RFAAVSPSGDL YAH +F P P TFFYNT+IRGYAK Sbjct: 3 RFAAVSPSGDLPYAHRMFDQMPQPKTFFYNTIIRGYAK 40 >gb|KGN62019.1| hypothetical protein Csa_2G286520 [Cucumis sativus] Length = 471 Score = 64.7 bits (156), Expect = 2e-08 Identities = 35/98 (35%), Positives = 49/98 (50%), Gaps = 1/98 (1%) Frame = +2 Query: 2 SISIFNSCSNNAAMSHDPDLVSHLLSLS-QRCTSMRELKTIHGRXXXXXXXXXXXXXXXX 178 S+ S +N+ + V L S ++C+SMRELK +H R Sbjct: 23 SVPTHPSANNSTSPLDFKSSVHQSLDFSLEKCSSMRELKVLHARIILQGLVSQNITLGKL 82 Query: 179 XRFAAVSPSGDLHYAHTLFSNTPHPDTFFYNTLIRGYA 292 F +VS GDLHYAH +F + P P+ F +N LIRGY+ Sbjct: 83 ISFCSVSQVGDLHYAHLVFDHLPQPNKFMFNCLIRGYS 120 >ref|XP_011659892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 619 Score = 63.5 bits (153), Expect = 5e-08 Identities = 34/80 (42%), Positives = 42/80 (52%) Frame = +2 Query: 50 DPDLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXXRFAAVSPSGDLHYAHT 229 +P + H LS C+SM ELK H + +F AVS GDLHYA Sbjct: 20 NPSPIFHSLS---SCSSMSELKQFHSQIIRLGLSTDNNAIGRLIKFCAVSKYGDLHYALL 76 Query: 230 LFSNTPHPDTFFYNTLIRGY 289 LF++ P+PD F YNTLIR Y Sbjct: 77 LFNSIPYPDAFIYNTLIRAY 96