BLASTX nr result
ID: Cinnamomum23_contig00041090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00041090 (272 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM90336.1| hypothetical protein ANO11243_083790 [fungal sp.... 69 9e-10 gb|KEQ63167.1| hypothetical protein M437DRAFT_75057 [Aureobasidi... 69 9e-10 ref|XP_007674385.1| hypothetical protein BAUCODRAFT_32024, parti... 69 9e-10 ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria trit... 69 9e-10 gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein ... 68 3e-09 ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [... 67 4e-09 ref|XP_007691860.1| hypothetical protein COCMIDRAFT_40237 [Bipol... 67 4e-09 ref|XP_007698386.1| hypothetical protein COCSADRAFT_35728 [Bipol... 67 4e-09 gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina M... 67 4e-09 ref|XP_003303585.1| 40S ribosomal protein S27 [Pyrenophora teres... 67 4e-09 ref|XP_001791644.1| hypothetical protein SNOG_00983 [Phaeosphaer... 67 4e-09 dbj|GAO85615.1| 40S ribosomal protein S27 [Neosartorya udagawae] 67 5e-09 gb|KMK60678.1| aminoalcoholphosphotransferase [Aspergillus fumig... 67 5e-09 gb|KKK16490.1| hypothetical protein ARAM_000415 [Aspergillus ram... 67 5e-09 gb|KJK67930.1| Ribosomal protein S27 [Aspergillus parasiticus SU-1] 67 5e-09 gb|KJJ31544.1| Ribosomal protein S27 [Aspergillus flavus AF70] 67 5e-09 gb|KIV79589.1| 40S ribosomal protein S27 [Exophiala sideris] 67 5e-09 ref|XP_754942.1| 40S ribosomal protein S27 [Aspergillus fumigatu... 67 5e-09 ref|XP_003190521.1| 40S ribosomal protein S27 [Aspergillus oryza... 67 5e-09 gb|EDP53070.1| 40S ribosomal protein S27, putative [Aspergillus ... 67 5e-09 >dbj|GAM90336.1| hypothetical protein ANO11243_083790 [fungal sp. No.11243] Length = 82 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|KEQ63167.1| hypothetical protein M437DRAFT_75057 [Aureobasidium melanogenum CBS 110374] gi|662513772|gb|KEQ71342.1| hypothetical protein M436DRAFT_74432 [Aureobasidium namibiae CBS 147.97] gi|662529849|gb|KEQ87224.1| hypothetical protein M438DRAFT_372758 [Aureobasidium pullulans EXF-150] gi|662537856|gb|KEQ95164.1| hypothetical protein AUEXF2481DRAFT_40431 [Aureobasidium subglaciale EXF-2481] Length = 82 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007674385.1| hypothetical protein BAUCODRAFT_32024, partial [Baudoinia compniacensis UAMH 10762] gi|449302012|gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [Baudoinia compniacensis UAMH 10762] Length = 81 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 51 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 81 >ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria tritici IPO323] gi|631378854|ref|XP_007923807.1| hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] gi|339467582|gb|EGP82685.1| hypothetical protein MYCGRDRAFT_64763 [Zymoseptoria tritici IPO323] gi|452986834|gb|EME86590.1| hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] gi|453079947|gb|EMF07999.1| 40S ribosomal protein S27 [Sphaerulina musiva SO2202] gi|796696605|gb|KJX95277.1| 40s ribosomal protein s27 [Zymoseptoria brevis] Length = 82 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein [Dothistroma septosporum NZE10] Length = 82 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVV CAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVTCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] gi|485917878|gb|EOD44675.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] Length = 82 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007691860.1| hypothetical protein COCMIDRAFT_40237 [Bipolaris oryzae ATCC 44560] gi|628201203|ref|XP_007710962.1| hypothetical protein COCCADRAFT_35661 [Bipolaris zeicola 26-R-13] gi|451997278|gb|EMD89743.1| hypothetical protein COCHEDRAFT_9327 [Bipolaris maydis C5] gi|477592974|gb|ENI10044.1| hypothetical protein COCC4DRAFT_29847 [Bipolaris maydis ATCC 48331] gi|576920577|gb|EUC34731.1| hypothetical protein COCCADRAFT_35661 [Bipolaris zeicola 26-R-13] gi|576927961|gb|EUC41623.1| hypothetical protein COCMIDRAFT_40237 [Bipolaris oryzae ATCC 44560] gi|578484555|gb|EUN22076.1| hypothetical protein COCVIDRAFT_42089 [Bipolaris victoriae FI3] Length = 82 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007698386.1| hypothetical protein COCSADRAFT_35728 [Bipolaris sorokiniana ND90Pr] gi|451852396|gb|EMD65691.1| hypothetical protein COCSADRAFT_35728 [Bipolaris sorokiniana ND90Pr] Length = 82 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] gi|821074086|gb|KKY28981.1| putative 40s ribosomal protein s27 [Diplodia seriata] Length = 82 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003303585.1| 40S ribosomal protein S27 [Pyrenophora teres f. teres 0-1] gi|311320339|gb|EFQ88323.1| hypothetical protein PTT_15845 [Pyrenophora teres f. teres 0-1] Length = 137 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 107 TVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 137 >ref|XP_001791644.1| hypothetical protein SNOG_00983 [Phaeosphaeria nodorum SN15] gi|189202210|ref|XP_001937441.1| 40S ribosomal protein S27 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|396468832|ref|XP_003838268.1| similar to 40s ribosomal protein s27 [Leptosphaeria maculans JN3] gi|636599439|ref|XP_008031058.1| hypothetical protein SETTUDRAFT_157561 [Setosphaeria turcica Et28A] gi|111071358|gb|EAT92478.1| hypothetical protein SNOG_00983 [Phaeosphaeria nodorum SN15] gi|187984540|gb|EDU50028.1| 40S ribosomal protein S27 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|312214835|emb|CBX94789.1| similar to 40s ribosomal protein s27 [Leptosphaeria maculans JN3] gi|482804547|gb|EOA81659.1| hypothetical protein SETTUDRAFT_157561 [Setosphaeria turcica Et28A] Length = 82 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >dbj|GAO85615.1| 40S ribosomal protein S27 [Neosartorya udagawae] Length = 392 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 362 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 392 >gb|KMK60678.1| aminoalcoholphosphotransferase [Aspergillus fumigatus Z5] Length = 521 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 491 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 521 >gb|KKK16490.1| hypothetical protein ARAM_000415 [Aspergillus rambellii] Length = 479 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 449 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 479 >gb|KJK67930.1| Ribosomal protein S27 [Aspergillus parasiticus SU-1] Length = 487 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 457 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 487 >gb|KJJ31544.1| Ribosomal protein S27 [Aspergillus flavus AF70] Length = 494 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 464 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 494 >gb|KIV79589.1| 40S ribosomal protein S27 [Exophiala sideris] Length = 350 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 320 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 350 >ref|XP_754942.1| 40S ribosomal protein S27 [Aspergillus fumigatus Af293] gi|121704840|ref|XP_001270683.1| 40S ribosomal protein S27 [Aspergillus clavatus NRRL 1] gi|66852579|gb|EAL92904.1| 40S ribosomal protein S27, putative [Aspergillus fumigatus Af293] gi|119398829|gb|EAW09257.1| 40S ribosomal protein S27, putative [Aspergillus clavatus NRRL 1] Length = 82 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003190521.1| 40S ribosomal protein S27 [Aspergillus oryzae RIB40] gi|816344997|gb|KKK21691.1| 40S ribosomal protein [Aspergillus ochraceoroseus] Length = 82 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 52 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >gb|EDP53070.1| 40S ribosomal protein S27, putative [Aspergillus fumigatus A1163] Length = 112 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 272 TVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 180 TVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 82 TVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 112