BLASTX nr result
ID: Cinnamomum23_contig00040921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00040921 (206 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007287913.1| hypothetical protein MBM_00024 [Marssonina b... 57 5e-06 ref|XP_001793853.1| hypothetical protein SNOG_03283 [Phaeosphaer... 57 5e-06 ref|XP_003848697.1| hypothetical protein MYCGRDRAFT_111195 [Zymo... 57 6e-06 ref|XP_007697849.1| hypothetical protein COCSADRAFT_297237 [Bipo... 56 8e-06 >ref|XP_007287913.1| hypothetical protein MBM_00024 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867874|gb|EKD20911.1| hypothetical protein MBM_00024 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 446 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 206 HQFFVDTKAIPPRSTWVHPYDDETYLRSL 120 HQFFVDT+A PPRS W HPYDDETYL SL Sbjct: 197 HQFFVDTRASPPRSIWHHPYDDETYLSSL 225 >ref|XP_001793853.1| hypothetical protein SNOG_03283 [Phaeosphaeria nodorum SN15] gi|111068894|gb|EAT90014.1| hypothetical protein SNOG_03283 [Phaeosphaeria nodorum SN15] Length = 405 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 206 HQFFVDTKAIPPRSTWVHPYDDETYLRSLS 117 HQFFVDT A PPRSTWVHP+DDE YL +LS Sbjct: 194 HQFFVDTTADPPRSTWVHPFDDEQYLSTLS 223 >ref|XP_003848697.1| hypothetical protein MYCGRDRAFT_111195 [Zymoseptoria tritici IPO323] gi|339468572|gb|EGP83673.1| hypothetical protein MYCGRDRAFT_111195 [Zymoseptoria tritici IPO323] Length = 345 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 206 HQFFVDTKAIPPRSTWVHPYDDETYLRSLS 117 HQF+VDT+A PPRSTW HPYDDE YL +LS Sbjct: 81 HQFYVDTRATPPRSTWDHPYDDEQYLATLS 110 >ref|XP_007697849.1| hypothetical protein COCSADRAFT_297237 [Bipolaris sorokiniana ND90Pr] gi|451853031|gb|EMD66325.1| hypothetical protein COCSADRAFT_297237 [Bipolaris sorokiniana ND90Pr] Length = 287 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 206 HQFFVDTKAIPPRSTWVHPYDDETYLRSLS 117 HQFFVDT+A PPRS W HPYDDE YL +LS Sbjct: 73 HQFFVDTRANPPRSIWTHPYDDEEYLNTLS 102