BLASTX nr result
ID: Cinnamomum23_contig00040770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00040770 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200213.1| hypothetical protein PRUPE_ppa015697mg [Prun... 46 1e-08 ref|XP_007027874.1| DNA/RNA polymerases superfamily protein [The... 44 5e-06 ref|XP_007049887.1| DNA/RNA polymerases superfamily protein [The... 44 5e-06 >ref|XP_007200213.1| hypothetical protein PRUPE_ppa015697mg [Prunus persica] gi|462395613|gb|EMJ01412.1| hypothetical protein PRUPE_ppa015697mg [Prunus persica] Length = 983 Score = 45.8 bits (107), Expect(2) = 1e-08 Identities = 19/37 (51%), Positives = 28/37 (75%) Frame = +3 Query: 36 VEDEEKEFAQPVFDDSGEDDQEVDVLPVEGESLVVRR 146 V E +F +P +DD G +++ +++LPVEGESLVVRR Sbjct: 166 VRSEVTDFPEPTYDDFGNEEEVINLLPVEGESLVVRR 202 Score = 39.7 bits (91), Expect(2) = 1e-08 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +1 Query: 148 MIVPKVEDNEDWRRYNIFRTCVFCNGK 228 M PKVE+ EDWR +NIFRT V C GK Sbjct: 204 MTTPKVEE-EDWRHHNIFRTRVLCGGK 229 >ref|XP_007027874.1| DNA/RNA polymerases superfamily protein [Theobroma cacao] gi|508716479|gb|EOY08376.1| DNA/RNA polymerases superfamily protein [Theobroma cacao] Length = 558 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 21/45 (46%), Positives = 33/45 (73%) Frame = +3 Query: 12 KKRVNLIDVEDEEKEFAQPVFDDSGEDDQEVDVLPVEGESLVVRR 146 ++RVNL ++ +E +PV+D+ E+ +E+DV P +GESLVVRR Sbjct: 272 QRRVNLAELGEE----LEPVYDEYEEEVEEIDVYPAQGESLVVRR 312 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 166 EDNEDWRRYNIFRTCVFCNGK 228 E+ EDW+R +IFRT V C GK Sbjct: 320 EEAEDWKRRSIFRTRVVCEGK 340 >ref|XP_007049887.1| DNA/RNA polymerases superfamily protein [Theobroma cacao] gi|508702148|gb|EOX94044.1| DNA/RNA polymerases superfamily protein [Theobroma cacao] Length = 546 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 21/45 (46%), Positives = 33/45 (73%) Frame = +3 Query: 12 KKRVNLIDVEDEEKEFAQPVFDDSGEDDQEVDVLPVEGESLVVRR 146 ++RVNL ++ +E +PV+D+ E+ +E+DV P +GESLVVRR Sbjct: 276 QRRVNLAELGEE----LEPVYDEYEEEVEEIDVYPAQGESLVVRR 316 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 166 EDNEDWRRYNIFRTCVFCNGK 228 E+ EDW+R +IFRT V C GK Sbjct: 324 EEAEDWKRRSIFRTRVVCEGK 344