BLASTX nr result
ID: Cinnamomum23_contig00040640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00040640 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14717.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_009779924.1| PREDICTED: disease resistance protein RPS2-l... 57 6e-06 >emb|CDP14717.1| unnamed protein product [Coffea canephora] Length = 971 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/74 (35%), Positives = 50/74 (67%) Frame = -2 Query: 232 PDIKELKIKYIPELLVLCKGIPSPDALKSLQSLYVSRCHRLKYLLPARLLQQLRCLKRIT 53 P ++ L+I+ + +L C GIP L +L+ L+V++C+ LK +L L+Q L+ L+ I Sbjct: 756 PTLESLEIEGLGKLHTFCMGIPQEGTLANLKVLHVTQCNDLKTVLSFELVQNLKSLEEIV 815 Query: 52 VKVCDKMKEIVGEE 11 ++ C++++EI+G+E Sbjct: 816 IENCERIEEIIGDE 829 >ref|XP_009779924.1| PREDICTED: disease resistance protein RPS2-like [Nicotiana sylvestris] gi|698453348|ref|XP_009779925.1| PREDICTED: disease resistance protein RPS2-like [Nicotiana sylvestris] Length = 1002 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/75 (40%), Positives = 46/75 (61%) Frame = -2 Query: 232 PDIKELKIKYIPELLVLCKGIPSPDALKSLQSLYVSRCHRLKYLLPARLLQQLRCLKRIT 53 P+++ L+I+ + L +CKGIP L +L+ L V+ C L LLP L+QQL L+ I Sbjct: 799 PELELLEIEGLSRLQNICKGIPPAGTLSTLKVLNVTACDNLTTLLPLELVQQLNNLEEIE 858 Query: 52 VKVCDKMKEIVGEEE 8 ++ C ++EIV E E Sbjct: 859 LRSCLMLEEIVTEAE 873