BLASTX nr result
ID: Cinnamomum23_contig00040325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00040325 (201 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012084423.1| PREDICTED: amidophosphoribosyltransferase, c... 84 5e-14 gb|EPS72386.1| amidophosphoribosyltransferase, partial [Genlisea... 82 1e-13 ref|XP_011088542.1| PREDICTED: amidophosphoribosyltransferase, c... 82 1e-13 ref|XP_012436311.1| PREDICTED: amidophosphoribosyltransferase, c... 82 2e-13 ref|XP_010247381.1| PREDICTED: amidophosphoribosyltransferase, c... 82 2e-13 ref|XP_002313004.2| hypothetical protein POPTR_0009s12850g [Popu... 82 2e-13 ref|XP_010669676.1| PREDICTED: amidophosphoribosyltransferase, c... 81 2e-13 ref|XP_009761534.1| PREDICTED: amidophosphoribosyltransferase, c... 81 2e-13 ref|XP_009601258.1| PREDICTED: amidophosphoribosyltransferase, c... 81 2e-13 ref|XP_008236822.1| PREDICTED: amidophosphoribosyltransferase, c... 81 2e-13 ref|XP_006387590.1| hypothetical protein POPTR_0803s00200g [Popu... 81 2e-13 ref|XP_007133325.1| hypothetical protein PHAVU_011G170200g [Phas... 81 2e-13 ref|XP_007132548.1| hypothetical protein PHAVU_011G103800g [Phas... 81 2e-13 ref|XP_006384532.1| hypothetical protein POPTR_0004s17100g [Popu... 81 2e-13 ref|XP_007042001.1| GLN phosphoribosyl pyrophosphate amidotransf... 81 2e-13 ref|XP_007201722.1| hypothetical protein PRUPE_ppa003335mg [Prun... 81 2e-13 ref|XP_003533491.1| PREDICTED: amidophosphoribosyltransferase 1,... 81 2e-13 ref|XP_006409423.1| hypothetical protein EUTSA_v10022626mg [Eutr... 81 3e-13 ref|XP_006842161.1| PREDICTED: amidophosphoribosyltransferase, c... 81 3e-13 ref|XP_012480422.1| PREDICTED: amidophosphoribosyltransferase, c... 80 4e-13 >ref|XP_012084423.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic [Jatropha curcas] gi|643715686|gb|KDP27627.1| hypothetical protein JCGZ_19632 [Jatropha curcas] Length = 586 Score = 83.6 bits (205), Expect = 5e-14 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 126 NFLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 +F + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 82 SFFDDDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 123 >gb|EPS72386.1| amidophosphoribosyltransferase, partial [Genlisea aurea] Length = 555 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 FLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 F E DKPREECG+VGIYGDPE+SRLCYLALHALQHRGQEG Sbjct: 72 FSDEDDKPREECGVVGIYGDPESSRLCYLALHALQHRGQEG 112 >ref|XP_011088542.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic [Sesamum indicum] Length = 583 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 FLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 F + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 77 FHDDDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 117 >ref|XP_012436311.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Gossypium raimondii] gi|763780515|gb|KJB47586.1| hypothetical protein B456_008G032300 [Gossypium raimondii] Length = 586 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/66 (60%), Positives = 45/66 (68%) Frame = -1 Query: 198 SSSKNXXXXXXXXXXXXXXXXXXSNFLPESDKPREECGIVGIYGDPEASRLCYLALHALQ 19 +SSKN S+F + DKPREECG+VGI+GDPEASRLCYLALHALQ Sbjct: 56 TSSKNPISDLFPPNKSGPEGDIVSSFSDDDDKPREECGVVGIFGDPEASRLCYLALHALQ 115 Query: 18 HRGQEG 1 HRGQEG Sbjct: 116 HRGQEG 121 >ref|XP_010247381.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Nelumbo nucifera] Length = 576 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 ++DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 81 DNDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 118 >ref|XP_002313004.2| hypothetical protein POPTR_0009s12850g [Populus trichocarpa] gi|118485692|gb|ABK94696.1| unknown [Populus trichocarpa] gi|550331613|gb|EEE86959.2| hypothetical protein POPTR_0009s12850g [Populus trichocarpa] Length = 585 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 123 FLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 F + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 80 FDDDDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 120 >ref|XP_010669676.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Beta vulgaris subsp. vulgaris] gi|870866776|gb|KMT17709.1| hypothetical protein BVRB_2g036540 [Beta vulgaris subsp. vulgaris] Length = 565 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 123 FLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 F+ +KPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 67 FVDSDEKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 107 >ref|XP_009761534.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Nicotiana sylvestris] Length = 559 Score = 81.3 bits (199), Expect = 2e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 126 NFLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 ++ + DKPREECG+VGIYGDPEASRLCYLALH+LQHRGQEG Sbjct: 81 SYFDDDDKPREECGVVGIYGDPEASRLCYLALHSLQHRGQEG 122 >ref|XP_009601258.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic-like [Nicotiana tomentosiformis] Length = 553 Score = 81.3 bits (199), Expect = 2e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 126 NFLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 ++ + DKPREECG+VGIYGDPEASRLCYLALH+LQHRGQEG Sbjct: 80 SYFDDDDKPREECGVVGIYGDPEASRLCYLALHSLQHRGQEG 121 >ref|XP_008236822.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic [Prunus mume] Length = 584 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 85 DDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 122 >ref|XP_006387590.1| hypothetical protein POPTR_0803s00200g [Populus trichocarpa] gi|550307756|gb|ERP46504.1| hypothetical protein POPTR_0803s00200g [Populus trichocarpa] Length = 586 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 123 FLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 F + DKPREECG+VG+YGDPEASRLCYLALHALQHRGQEG Sbjct: 80 FDDDDDKPREECGVVGVYGDPEASRLCYLALHALQHRGQEG 120 >ref|XP_007133325.1| hypothetical protein PHAVU_011G170200g [Phaseolus vulgaris] gi|561006325|gb|ESW05319.1| hypothetical protein PHAVU_011G170200g [Phaseolus vulgaris] Length = 553 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 67 DDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 104 >ref|XP_007132548.1| hypothetical protein PHAVU_011G103800g [Phaseolus vulgaris] gi|561005548|gb|ESW04542.1| hypothetical protein PHAVU_011G103800g [Phaseolus vulgaris] Length = 558 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 67 DDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 104 >ref|XP_006384532.1| hypothetical protein POPTR_0004s17100g [Populus trichocarpa] gi|550341214|gb|ERP62329.1| hypothetical protein POPTR_0004s17100g [Populus trichocarpa] Length = 586 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 123 FLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 F + DKPREECG+VG+YGDPEASRLCYLALHALQHRGQEG Sbjct: 80 FDDDDDKPREECGVVGVYGDPEASRLCYLALHALQHRGQEG 120 >ref|XP_007042001.1| GLN phosphoribosyl pyrophosphate amidotransferase 1 [Theobroma cacao] gi|508705936|gb|EOX97832.1| GLN phosphoribosyl pyrophosphate amidotransferase 1 [Theobroma cacao] Length = 594 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 126 NFLPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 +F + DKPREECG+VGI+GDPEASRLCYLALHALQHRGQEG Sbjct: 88 SFSDDDDKPREECGVVGIFGDPEASRLCYLALHALQHRGQEG 129 >ref|XP_007201722.1| hypothetical protein PRUPE_ppa003335mg [Prunus persica] gi|462397122|gb|EMJ02921.1| hypothetical protein PRUPE_ppa003335mg [Prunus persica] Length = 584 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 85 DDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 122 >ref|XP_003533491.1| PREDICTED: amidophosphoribosyltransferase 1, chloroplastic-like [Glycine max] Length = 511 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 + DKPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 52 DDDKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 89 >ref|XP_006409423.1| hypothetical protein EUTSA_v10022626mg [Eutrema salsugineum] gi|557110585|gb|ESQ50876.1| hypothetical protein EUTSA_v10022626mg [Eutrema salsugineum] Length = 562 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 114 ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 E +KPREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 79 EDEKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 116 >ref|XP_006842161.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic [Amborella trichopoda] gi|548844210|gb|ERN03836.1| hypothetical protein AMTR_s00078p00141340 [Amborella trichopoda] Length = 603 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 120 LPESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 L E D PREECG+VGIYGDPEASRLCYLALHALQHRGQEG Sbjct: 120 LVEDDHPREECGVVGIYGDPEASRLCYLALHALQHRGQEG 159 >ref|XP_012480422.1| PREDICTED: amidophosphoribosyltransferase, chloroplastic [Gossypium raimondii] Length = 582 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 3/45 (6%) Frame = -1 Query: 126 NFLP---ESDKPREECGIVGIYGDPEASRLCYLALHALQHRGQEG 1 +F+P + DKPREECG+VGI+GDPEASRLCYLALHALQHRGQEG Sbjct: 73 SFIPSFTDDDKPREECGVVGIFGDPEASRLCYLALHALQHRGQEG 117