BLASTX nr result
ID: Cinnamomum23_contig00040254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00040254 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086309.1| PREDICTED: uncharacterized WD repeat-contain... 39 2e-08 ref|XP_011086311.1| PREDICTED: uncharacterized WD repeat-contain... 39 2e-08 ref|XP_011095852.1| PREDICTED: uncharacterized WD repeat-contain... 38 4e-08 ref|XP_011095853.1| PREDICTED: uncharacterized WD repeat-contain... 38 4e-08 ref|XP_004953721.1| PREDICTED: uncharacterized WD repeat-contain... 36 6e-08 ref|XP_012841910.1| PREDICTED: uncharacterized WD repeat-contain... 36 1e-07 ref|XP_010913270.1| PREDICTED: uncharacterized WD repeat-contain... 36 1e-07 ref|XP_011005784.1| PREDICTED: uncharacterized WD repeat-contain... 35 1e-07 ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Popu... 35 1e-07 ref|XP_010252904.1| PREDICTED: uncharacterized WD repeat-contain... 36 1e-07 ref|XP_008805522.1| PREDICTED: uncharacterized WD repeat-contain... 35 2e-07 gb|EPS58082.1| hypothetical protein M569_16734, partial [Genlise... 36 2e-07 gb|EMT06758.1| Putative WD repeat-containing protein [Aegilops t... 36 3e-07 dbj|BAK05644.1| predicted protein [Hordeum vulgare subsp. vulgare] 36 3e-07 ref|XP_012849044.1| PREDICTED: uncharacterized WD repeat-contain... 38 3e-07 ref|XP_009415403.1| PREDICTED: uncharacterized WD repeat-contain... 36 4e-07 ref|XP_010096515.1| Uncharacterized WD repeat-containing protein... 35 8e-07 ref|XP_010552324.1| PREDICTED: uncharacterized WD repeat-contain... 37 8e-07 ref|XP_002452638.1| hypothetical protein SORBIDRAFT_04g029600 [S... 36 8e-07 gb|ACG42420.1| WD-repeat protein-like [Zea mays] 36 8e-07 >ref|XP_011086309.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Sesamum indicum] gi|747078310|ref|XP_011086310.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Sesamum indicum] Length = 439 Score = 38.9 bits (89), Expect(3) = 2e-08 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +NDY+ +QEI FF Sbjct: 373 EPADFVHVYDVKNDYEKEQEIDFF 396 Score = 33.9 bits (76), Expect(3) = 2e-08 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ ++ SYLDSL Sbjct: 416 WDRTYGSLLQYNRCRNYSYLDSL 438 Score = 31.6 bits (70), Expect(3) = 2e-08 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 357 IRSIRFTSDGQFMAM 371 >ref|XP_011086311.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Sesamum indicum] Length = 432 Score = 38.9 bits (89), Expect(3) = 2e-08 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +NDY+ +QEI FF Sbjct: 366 EPADFVHVYDVKNDYEKEQEIDFF 389 Score = 33.9 bits (76), Expect(3) = 2e-08 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ ++ SYLDSL Sbjct: 409 WDRTYGSLLQYNRCRNYSYLDSL 431 Score = 31.6 bits (70), Expect(3) = 2e-08 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 350 IRSIRFTSDGQFMAM 364 >ref|XP_011095852.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Sesamum indicum] Length = 446 Score = 37.7 bits (86), Expect(3) = 4e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N YD +QEI FF Sbjct: 380 EPADFVHVYDVKNGYDKEQEIDFF 403 Score = 33.9 bits (76), Expect(3) = 4e-08 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ ++ SYLDSL Sbjct: 423 WDRTYGSLLQYNRCRNYSYLDSL 445 Score = 31.6 bits (70), Expect(3) = 4e-08 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 364 IRSIRFTSDGQFMAM 378 >ref|XP_011095853.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Sesamum indicum] Length = 443 Score = 37.7 bits (86), Expect(3) = 4e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N YD +QEI FF Sbjct: 377 EPADFVHVYDVKNGYDKEQEIDFF 400 Score = 33.9 bits (76), Expect(3) = 4e-08 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ ++ SYLDSL Sbjct: 420 WDRTYGSLLQYNRCRNYSYLDSL 442 Score = 31.6 bits (70), Expect(3) = 4e-08 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 361 IRSIRFTSDGQFMAM 375 >ref|XP_004953721.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Setaria italica] Length = 452 Score = 36.2 bits (82), Expect(3) = 6e-08 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D ++DY+ +QE+ FF Sbjct: 386 EPADFVHVYDVKSDYNRRQELDFF 409 Score = 34.7 bits (78), Expect(3) = 6e-08 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -1 Query: 250 DLFLLLDWDCTYGILVQYSQNQSLSYLDSLF 158 D+ + WD TYG L+Q+ + + SYLDSLF Sbjct: 422 DMLFVGVWDRTYGSLLQFGRLHNYSYLDSLF 452 Score = 31.6 bits (70), Expect(3) = 6e-08 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 370 IRSIRFTSDGQFMSM 384 >ref|XP_012841910.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Erythranthe guttatus] gi|604328147|gb|EYU33815.1| hypothetical protein MIMGU_mgv1a006363mg [Erythranthe guttata] Length = 447 Score = 36.2 bits (82), Expect(3) = 1e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N Y+ +QEI FF Sbjct: 381 EPADFVHVYDVKNGYEKEQEIDFF 404 Score = 33.9 bits (76), Expect(3) = 1e-07 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ ++ SYLDSL Sbjct: 424 WDRTYGSLLQYNRCRNYSYLDSL 446 Score = 31.6 bits (70), Expect(3) = 1e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 365 IRSIRFTSDGQFMAM 379 >ref|XP_010913270.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Elaeis guineensis] Length = 446 Score = 35.8 bits (81), Expect(3) = 1e-07 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QYS+ Q SYLDSL Sbjct: 423 WDRTYGSLLQYSRLQHYSYLDSL 445 Score = 34.3 bits (77), Expect(3) = 1e-07 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D R+ Y+ +QE+ FF Sbjct: 380 EPADFVHIFDVRSGYNRRQELDFF 403 Score = 31.6 bits (70), Expect(3) = 1e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 364 IRSIRFTSDGQFMAM 378 >ref|XP_011005784.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Populus euphratica] Length = 448 Score = 35.0 bits (79), Expect(3) = 1e-07 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ +S SY+DSL Sbjct: 425 WDRTYGSLLQYNRRRSYSYVDSL 447 Score = 34.7 bits (78), Expect(3) = 1e-07 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N ++ +QEI FF Sbjct: 382 EPADFVHVYDAKNGFEKEQEIDFF 405 Score = 31.6 bits (70), Expect(3) = 1e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 366 IRSIRFTSDGQFMSM 380 >ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] gi|222854709|gb|EEE92256.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] Length = 448 Score = 35.0 bits (79), Expect(3) = 1e-07 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ +S SY+DSL Sbjct: 425 WDRTYGSLLQYNRRRSYSYVDSL 447 Score = 34.7 bits (78), Expect(3) = 1e-07 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N ++ +QEI FF Sbjct: 382 EPADFVHVYDAKNGFEKEQEIDFF 405 Score = 31.6 bits (70), Expect(3) = 1e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 366 IRSIRFTSDGQFMSM 380 >ref|XP_010252904.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Nelumbo nucifera] gi|719990262|ref|XP_010252905.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Nelumbo nucifera] gi|719990266|ref|XP_010252906.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Nelumbo nucifera] Length = 446 Score = 36.2 bits (82), Expect(3) = 1e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N Y+ +QEI FF Sbjct: 380 EPADFVHVYDAKNGYEKQQEIDFF 403 Score = 33.5 bits (75), Expect(3) = 1e-07 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY + ++ SYLDSL Sbjct: 423 WDRTYGSLLQYGRCRNYSYLDSL 445 Score = 31.6 bits (70), Expect(3) = 1e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 364 IRSIRFTSDGQFMAM 378 >ref|XP_008805522.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Phoenix dactylifera] Length = 446 Score = 35.0 bits (79), Expect(3) = 2e-07 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QYS+ ++ SYLDSL Sbjct: 423 WDRTYGSLLQYSRLRNYSYLDSL 445 Score = 34.3 bits (77), Expect(3) = 2e-07 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D R+ Y+ +QE+ FF Sbjct: 380 EPADFVHIFDVRSGYNKRQELDFF 403 Score = 31.6 bits (70), Expect(3) = 2e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 364 IRSIRFTSDGQFMAM 378 >gb|EPS58082.1| hypothetical protein M569_16734, partial [Genlisea aurea] Length = 166 Score = 35.8 bits (81), Expect(3) = 2e-07 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N+++ +QEI FF Sbjct: 100 EPADFVHVYDVKNEFEKEQEIDFF 123 Score = 33.1 bits (74), Expect(3) = 2e-07 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++ ++ SYLDS+ Sbjct: 143 WDRTYGSLLQYNRCRNYSYLDSI 165 Score = 31.6 bits (70), Expect(3) = 2e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 84 IRSIRFTSDGQFMSM 98 >gb|EMT06758.1| Putative WD repeat-containing protein [Aegilops tauschii] Length = 517 Score = 35.8 bits (81), Expect(3) = 3e-07 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D ++DY+ +QE+ FF Sbjct: 451 EPADFVHIFDVKSDYNKRQELDFF 474 Score = 35.0 bits (79), Expect(3) = 3e-07 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSLF 158 WD TYG L+QY + + SYLDSLF Sbjct: 494 WDRTYGSLLQYGRLYNYSYLDSLF 517 Score = 29.3 bits (64), Expect(3) = 3e-07 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIR+TSDGQF+ M Sbjct: 435 IRSIRYTSDGQFLSM 449 >dbj|BAK05644.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 446 Score = 35.8 bits (81), Expect(3) = 3e-07 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D ++DY+ +QE+ FF Sbjct: 380 EPADFVHIFDVKSDYNKRQELDFF 403 Score = 35.0 bits (79), Expect(3) = 3e-07 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSLF 158 WD TYG L+QY + + SYLDSLF Sbjct: 423 WDRTYGSLLQYGRLYNYSYLDSLF 446 Score = 29.3 bits (64), Expect(3) = 3e-07 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIR+TSDGQF+ M Sbjct: 364 IRSIRYTSDGQFLSM 378 >ref|XP_012849044.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Erythranthe guttatus] gi|848897895|ref|XP_012849045.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Erythranthe guttatus] gi|604314910|gb|EYU27616.1| hypothetical protein MIMGU_mgv1a006397mg [Erythranthe guttata] Length = 445 Score = 37.7 bits (86), Expect(3) = 3e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N YD +QEI FF Sbjct: 381 EPADFVHVYDVKNGYDKEQEIDFF 404 Score = 31.6 bits (70), Expect(3) = 3e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 365 IRSIRFTSDGQFMAM 379 Score = 30.8 bits (68), Expect(3) = 3e-07 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLD 167 WD TYG L+QY++ ++ SYLD Sbjct: 424 WDRTYGSLLQYNRCRNYSYLD 444 >ref|XP_009415403.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Musa acuminata subsp. malaccensis] Length = 446 Score = 36.2 bits (82), Expect(3) = 4e-07 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D RN Y+ +QE+ FF Sbjct: 380 EPADFVHIFDVRNGYNKRQELDFF 403 Score = 33.5 bits (75), Expect(3) = 4e-07 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QYS+ ++ SY DSL Sbjct: 423 WDRTYGSLLQYSRLRNYSYFDSL 445 Score = 30.0 bits (66), Expect(3) = 4e-07 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDG+FM M Sbjct: 364 IRSIRFTSDGRFMAM 378 >ref|XP_010096515.1| Uncharacterized WD repeat-containing protein [Morus notabilis] gi|587875526|gb|EXB64635.1| Uncharacterized WD repeat-containing protein [Morus notabilis] Length = 572 Score = 34.7 bits (78), Expect(3) = 8e-07 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D +N ++ +QEI FF Sbjct: 506 EPADFVHVYDAKNGFEKEQEIDFF 529 Score = 32.3 bits (72), Expect(3) = 8e-07 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSL 161 WD TYG L+QY++++ +YLDSL Sbjct: 549 WDRTYGSLLQYNRSRYNTYLDSL 571 Score = 31.6 bits (70), Expect(3) = 8e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 490 IRSIRFTSDGQFMAM 504 >ref|XP_010552324.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Tarenaya hassleriana] gi|729391282|ref|XP_010552325.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Tarenaya hassleriana] gi|729391285|ref|XP_010552326.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Tarenaya hassleriana] Length = 447 Score = 37.4 bits (85), Expect(3) = 8e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV+V D RN Y+ +QEI FF Sbjct: 381 EPADFVHVFDVRNGYEGEQEIDFF 404 Score = 33.5 bits (75), Expect(3) = 8e-07 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDS 164 WD TYG L++YS+ ++ SYLDS Sbjct: 424 WDRTYGSLMEYSRRRNYSYLDS 445 Score = 27.7 bits (60), Expect(3) = 8e-07 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIR+TSDG++M M Sbjct: 365 IRSIRYTSDGKYMAM 379 >ref|XP_002452638.1| hypothetical protein SORBIDRAFT_04g029600 [Sorghum bicolor] gi|241932469|gb|EES05614.1| hypothetical protein SORBIDRAFT_04g029600 [Sorghum bicolor] Length = 450 Score = 35.8 bits (81), Expect(3) = 8e-07 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D ++DY+ +QE+ FF Sbjct: 384 EPADFVHIYDVKSDYNKRQELDFF 407 Score = 31.6 bits (70), Expect(3) = 8e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 368 IRSIRFTSDGQFMSM 382 Score = 31.2 bits (69), Expect(3) = 8e-07 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSLF 158 WD YG L+Q+ + + SYLDSLF Sbjct: 427 WDRMYGSLLQFGRLYNYSYLDSLF 450 >gb|ACG42420.1| WD-repeat protein-like [Zea mays] Length = 446 Score = 35.8 bits (81), Expect(3) = 8e-07 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -2 Query: 309 EPADFVYVCDTRNDYDNKQEIYFF 238 EPADFV++ D ++DY+ +QE+ FF Sbjct: 380 EPADFVHIYDVKSDYNKRQELDFF 403 Score = 31.6 bits (70), Expect(3) = 8e-07 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 356 IRSIRFTSDGQFMGM 312 IRSIRFTSDGQFM M Sbjct: 364 IRSIRFTSDGQFMSM 378 Score = 31.2 bits (69), Expect(3) = 8e-07 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 229 WDCTYGILVQYSQNQSLSYLDSLF 158 WD YG L+Q+ + + SYLDSLF Sbjct: 423 WDRMYGSLLQFGRLYNYSYLDSLF 446