BLASTX nr result
ID: Cinnamomum23_contig00040017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00040017 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB55702.1| hypothetical protein CGLO_04345 [Colletotrichum g... 57 4e-06 ref|XP_007283574.1| glycine-rich cell wall structural protein 1 ... 57 4e-06 >gb|EQB55702.1| hypothetical protein CGLO_04345 [Colletotrichum gloeosporioides Cg-14] Length = 286 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 303 TSPKYVKSTGLAADGGDFDATKPGAGAEATR 211 T KYVKSTGLAADGGDFDATKPGAG EA R Sbjct: 199 TGEKYVKSTGLAADGGDFDATKPGAGREADR 229 >ref|XP_007283574.1| glycine-rich cell wall structural protein 1 [Colletotrichum gloeosporioides Nara gc5] gi|429852204|gb|ELA27350.1| glycine-rich cell wall structural protein 1 [Colletotrichum gloeosporioides Nara gc5] Length = 287 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 303 TSPKYVKSTGLAADGGDFDATKPGAGAEATR 211 T KYVKSTGLAADGGDFDATKPGAG EA R Sbjct: 200 TGEKYVKSTGLAADGGDFDATKPGAGREADR 230