BLASTX nr result
ID: Cinnamomum23_contig00039699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00039699 (251 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 gb|KHN17971.1| Pentatricopeptide repeat-containing protein, chlo... 80 4e-13 ref|XP_010246351.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_004293118.1| PREDICTED: pentatricopeptide repeat-containi... 80 7e-13 ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phas... 79 9e-13 ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 ref|XP_004487456.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_010092553.1| hypothetical protein L484_001219 [Morus nota... 77 3e-12 ref|XP_010685430.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_009374796.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_009371490.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_004251424.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_012857501.1| PREDICTED: pentatricopeptide repeat-containi... 77 6e-12 gb|EYU20651.1| hypothetical protein MIMGU_mgv1a0263782mg, partia... 77 6e-12 ref|XP_008376005.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 76 8e-12 ref|XP_006340426.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_012847930.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_012485161.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 emb|CBI24422.3| unnamed protein product [Vitis vinifera] 74 3e-11 ref|XP_002274209.2| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 >ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Glycine max] gi|734413051|gb|KHN36496.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 521 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 3/71 (4%) Frame = -1 Query: 206 DDDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH---SKSLRF 36 +D +V WT+SIA C++GHL KAAS +MR + IEPN ITF+TLLSAC+H S+ F Sbjct: 53 NDPIVSWTTSIADYCKSGHLVKAASKFVQMREAAIEPNHITFITLLSACAHYPSRSSISF 112 Query: 35 GLSIHAHLLKL 3 G +IHAH+ KL Sbjct: 113 GTAIHAHVRKL 123 >gb|KHN17971.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 450 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/70 (55%), Positives = 50/70 (71%), Gaps = 3/70 (4%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH---SKSLRFG 33 D +V WT+SIA C++GHL KAAS +MR + IEPN ITF+TLLSAC+H + FG Sbjct: 54 DPIVAWTTSIADCCKSGHLVKAASKFVQMREAAIEPNHITFITLLSACAHYPARTNFSFG 113 Query: 32 LSIHAHLLKL 3 +IHAH+ KL Sbjct: 114 TAIHAHVRKL 123 >ref|XP_010246351.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Nelumbo nucifera] Length = 523 Score = 80.1 bits (196), Expect = 5e-13 Identities = 40/69 (57%), Positives = 52/69 (75%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D +V WTSSI+R CRNG L++AA+ T MR S +EPN +TFVTLLSAC+ ++L FG Sbjct: 57 DPIVSWTSSISRRCRNGRLAEAAAQFTHMRISGVEPNYVTFVTLLSACADYPLETLSFGA 116 Query: 29 SIHAHLLKL 3 SIHA++ KL Sbjct: 117 SIHAYVRKL 125 >ref|XP_004293118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Fragaria vesca subsp. vesca] Length = 504 Score = 79.7 bits (195), Expect = 7e-13 Identities = 38/69 (55%), Positives = 51/69 (73%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D VLWTSSI++ CRNG L++A S +MR + +EPN ITFVTLLS C+H +K+ FG Sbjct: 43 DQTVLWTSSISQRCRNGQLAQAVSQFIQMRRARVEPNHITFVTLLSGCAHFPAKAAFFGP 102 Query: 29 SIHAHLLKL 3 S+HA++ KL Sbjct: 103 SLHAYVCKL 111 >ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] gi|561023297|gb|ESW22027.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] Length = 514 Score = 79.3 bits (194), Expect = 9e-13 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 3/70 (4%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH---SKSLRFG 33 D VV WTSSIA+ C+ GHL KAAS RMR +NIEPN IT +TLLS C+H S+ FG Sbjct: 47 DPVVAWTSSIAQYCKGGHLVKAASEFVRMREANIEPNHITLITLLSVCAHHPSQSSISFG 106 Query: 32 LSIHAHLLKL 3 +H + K+ Sbjct: 107 TIVHGYACKM 116 >ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Cucumis sativus] gi|700209875|gb|KGN64971.1| hypothetical protein Csa_1G169950 [Cucumis sativus] Length = 525 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/68 (57%), Positives = 50/68 (73%), Gaps = 2/68 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D +VLWTSS+AR CRNG LS+AA+ TRMR + +EPN ITF+TLLSAC+ S+S F Sbjct: 55 DPIVLWTSSLARYCRNGQLSEAAAEFTRMRLAGVEPNHITFITLLSACADFPSESFFFAS 114 Query: 29 SIHAHLLK 6 S+H + K Sbjct: 115 SLHGYACK 122 >ref|XP_004487456.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Cicer arietinum] Length = 512 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 3/64 (4%) Frame = -1 Query: 188 WTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSHSKS---LRFGLSIHA 18 WT++I+ CRNGHL +AAS TRMR S IEPN+IT +TLLSAC+H S + FG ++HA Sbjct: 50 WTATISHHCRNGHLHEAASEFTRMRESGIEPNNITLITLLSACAHQPSITTITFGATLHA 109 Query: 17 HLLK 6 + K Sbjct: 110 YAFK 113 >ref|XP_010092553.1| hypothetical protein L484_001219 [Morus notabilis] gi|587951969|gb|EXC37761.1| hypothetical protein L484_001219 [Morus notabilis] Length = 508 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSHSKSLRFGLSI 24 + VV WTSSIAR C+NG S+AA+ +RMR S +EPN +TFVTLLS C+ S ++ FG SI Sbjct: 48 EPVVKWTSSIARHCKNGRFSEAAAEFSRMRLSGVEPNHVTFVTLLSGCADS-NISFGASI 106 Query: 23 HAHLLKL 3 H + KL Sbjct: 107 HGYARKL 113 >ref|XP_010685430.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870853057|gb|KMT04938.1| hypothetical protein BVRB_7g171040 [Beta vulgaris subsp. vulgaris] Length = 500 Score = 77.4 bits (189), Expect = 3e-12 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D +V WTSSIAR C+NG LS A + TRMR S IEPN ITF+TLLS +H S+ F Sbjct: 38 DPIVPWTSSIARLCKNGKLSAAVNEFTRMRISGIEPNHITFITLLSGIAHYPSQGHHFAA 97 Query: 29 SIHAHLLKL 3 S+HA++LKL Sbjct: 98 SMHAYVLKL 106 >ref|XP_009374796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Pyrus x bretschneideri] Length = 521 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D V WTSSI+ CRNGHL++A + +MR + +EPN +TFVTLLS C+H +K + FG Sbjct: 55 DPTVSWTSSISHRCRNGHLAEALAHFIQMRRAGVEPNHVTFVTLLSGCAHFPAKGVLFGP 114 Query: 29 SIHAHLLKL 3 S+HA+ KL Sbjct: 115 SLHAYARKL 123 >ref|XP_009371490.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Pyrus x bretschneideri] Length = 521 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D V WTSSI+ CRNGHL++A + +MR + +EPN +TFVTLLS C+H +K + FG Sbjct: 55 DPTVSWTSSISHRCRNGHLAEALAHFIQMRRAGVEPNHVTFVTLLSGCAHFPAKGVLFGP 114 Query: 29 SIHAHLLKL 3 S+HA+ KL Sbjct: 115 SLHAYARKL 123 >ref|XP_004251424.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Solanum lycopersicum] Length = 507 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 2/75 (2%) Frame = -1 Query: 221 TPQRDDDDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SK 48 T + ++D WTS IAR C+NG L +A + TRMR+S +EPN ITFVTLLS C+H + Sbjct: 36 TYRSNNDSTASWTSLIARHCKNGRLIEAVAEFTRMRNSGVEPNHITFVTLLSCCAHFPDQ 95 Query: 47 SLRFGLSIHAHLLKL 3 +L FG ++H + KL Sbjct: 96 ALSFGSALHGYARKL 110 >ref|XP_012857501.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Erythranthe guttatus] Length = 355 Score = 76.6 bits (187), Expect = 6e-12 Identities = 39/64 (60%), Positives = 44/64 (68%), Gaps = 2/64 (3%) Frame = -1 Query: 188 WTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGLSIHAH 15 WTSSIA CRNG LS+A TRMR S +EPN ITFVTL SAC+H SK L G SIH + Sbjct: 64 WTSSIAHHCRNGRLSEAVLQFTRMRDSGVEPNHITFVTLFSACAHFPSKGLLLGPSIHGY 123 Query: 14 LLKL 3 K+ Sbjct: 124 ARKI 127 >gb|EYU20651.1| hypothetical protein MIMGU_mgv1a0263782mg, partial [Erythranthe guttata] Length = 139 Score = 76.6 bits (187), Expect = 6e-12 Identities = 39/64 (60%), Positives = 44/64 (68%), Gaps = 2/64 (3%) Frame = -1 Query: 188 WTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGLSIHAH 15 WTSSIA CRNG LS+A TRMR S +EPN ITFVTL SAC+H SK L G SIH + Sbjct: 64 WTSSIAHHCRNGRLSEAVLQFTRMRDSGVEPNHITFVTLFSACAHFPSKGLLLGPSIHGY 123 Query: 14 LLKL 3 K+ Sbjct: 124 ARKI 127 >ref|XP_008376005.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Malus domestica] Length = 521 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D WTSSI+ CRNGHL++A + +MR + +EPN +TFVTLLS C+H +K ++FG Sbjct: 55 DPTFSWTSSISHRCRNGHLAEALAHFIQMRRAGVEPNHVTFVTLLSGCAHFPAKGVQFGP 114 Query: 29 SIHAHLLKL 3 S+HA+ KL Sbjct: 115 SLHAYARKL 123 >ref|XP_006340426.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Solanum tuberosum] Length = 509 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 2/75 (2%) Frame = -1 Query: 221 TPQRDDDDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SK 48 T + ++D WTS IAR C+NG L +A S TRMR+S +EPN ITFVTLLS C+H ++ Sbjct: 38 TYRSNNDSTASWTSLIARHCKNGRLIEAVSEFTRMRNSGVEPNHITFVTLLSGCAHFPAQ 97 Query: 47 SLRFGLSIHAHLLKL 3 +L G ++H + KL Sbjct: 98 ALSLGSALHGYARKL 112 >ref|XP_012847930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Erythranthe guttatus] Length = 348 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = -1 Query: 188 WTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGLSIHAH 15 WTSSIA CRNG LS+A TRMR S +EPN ITFVTL S C+H SK L G SIH + Sbjct: 65 WTSSIAHHCRNGRLSEAVLQFTRMRDSGVEPNHITFVTLFSGCAHFPSKGLSLGPSIHGY 124 Query: 14 LLKL 3 K+ Sbjct: 125 ARKI 128 >ref|XP_012485161.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Gossypium raimondii] gi|763768228|gb|KJB35443.1| hypothetical protein B456_006G115100 [Gossypium raimondii] Length = 504 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/69 (56%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 + VVLWTSSI+R CR G LS+AA TRMR S +EPN ITF+TLLS C+ SK G Sbjct: 43 ESVVLWTSSISRHCRAGQLSQAAQEFTRMRLSGVEPNHITFITLLSGCAEFPSKGRDLGS 102 Query: 29 SIHAHLLKL 3 IH ++ KL Sbjct: 103 LIHGYVCKL 111 >emb|CBI24422.3| unnamed protein product [Vitis vinifera] Length = 502 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D +V WTSSIA CRNG L +AA+ +RM+ + + PN ITF+TLLSAC+ + LRFG Sbjct: 52 DPIVSWTSSIALHCRNGQLPEAAAEFSRMQIAGVRPNHITFLTLLSACTDFPLEGLRFGG 111 Query: 29 SIHAHLLKL 3 SIHA++ KL Sbjct: 112 SIHAYVRKL 120 >ref|XP_002274209.2| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Vitis vinifera] Length = 518 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 2/69 (2%) Frame = -1 Query: 203 DDVVLWTSSIARSCRNGHLSKAASALTRMRHSNIEPNDITFVTLLSACSH--SKSLRFGL 30 D +V WTSSIA CRNG L +AA+ +RM+ + + PN ITF+TLLSAC+ + LRFG Sbjct: 52 DPIVSWTSSIALHCRNGQLPEAAAEFSRMQIAGVRPNHITFLTLLSACTDFPLEGLRFGG 111 Query: 29 SIHAHLLKL 3 SIHA++ KL Sbjct: 112 SIHAYVRKL 120