BLASTX nr result
ID: Cinnamomum23_contig00039676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00039676 (448 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [P... 63 7e-08 ref|XP_008381164.1| PREDICTED: ubiquitin receptor RAD23b-like is... 63 7e-08 ref|XP_008381163.1| PREDICTED: ubiquitin receptor RAD23b-like is... 63 7e-08 ref|XP_012067446.1| PREDICTED: ubiquitin receptor RAD23b-like [J... 63 9e-08 ref|XP_009354240.1| PREDICTED: ubiquitin receptor RAD23b-like [P... 63 9e-08 ref|XP_008342756.1| PREDICTED: ubiquitin receptor RAD23b-like [M... 63 9e-08 ref|XP_008228865.1| PREDICTED: ubiquitin receptor RAD23b-like [P... 63 9e-08 gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas] 63 9e-08 ref|XP_007024818.1| Rad23 UV excision repair protein family isof... 63 9e-08 ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragar... 63 9e-08 ref|XP_007215553.1| hypothetical protein PRUPE_ppa007284mg [Prun... 63 9e-08 gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium r... 62 2e-07 ref|XP_012484759.1| PREDICTED: ubiquitin receptor RAD23b-like [G... 62 2e-07 ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [P... 62 2e-07 ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis ... 62 2e-07 gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossyp... 62 2e-07 ref|XP_011651807.1| PREDICTED: ubiquitin receptor RAD23b [Cucumi... 62 2e-07 emb|CDX81753.1| BnaC08g38480D [Brassica napus] 62 2e-07 ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23... 62 2e-07 ref|XP_008462954.1| PREDICTED: ubiquitin receptor RAD23b isoform... 62 2e-07 >ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri] Length = 374 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 334 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 374 >ref|XP_008381164.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Malus domestica] Length = 315 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 275 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 315 >ref|XP_008381163.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Malus domestica] Length = 374 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 334 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 374 >ref|XP_012067446.1| PREDICTED: ubiquitin receptor RAD23b-like [Jatropha curcas] Length = 375 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 335 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 375 >ref|XP_009354240.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri] gi|694390832|ref|XP_009370969.1| PREDICTED: ubiquitin receptor RAD23b [Pyrus x bretschneideri] Length = 369 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 329 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 369 >ref|XP_008342756.1| PREDICTED: ubiquitin receptor RAD23b-like [Malus domestica] Length = 369 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 329 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 369 >ref|XP_008228865.1| PREDICTED: ubiquitin receptor RAD23b-like [Prunus mume] Length = 374 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 334 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 374 >gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas] Length = 352 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 312 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 352 >ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma cacao] gi|508780184|gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma cacao] Length = 373 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 333 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 373 >ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca] Length = 371 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 331 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 371 >ref|XP_007215553.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica] gi|462411703|gb|EMJ16752.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica] Length = 374 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLENA D ED Sbjct: 334 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 374 >gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii] Length = 305 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLEN+ D ED Sbjct: 265 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED 305 >ref|XP_012484759.1| PREDICTED: ubiquitin receptor RAD23b-like [Gossypium raimondii] gi|763767705|gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii] Length = 373 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLEN+ D ED Sbjct: 333 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED 373 >ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica] Length = 372 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNE+LAA+YLLENA D ED Sbjct: 332 IERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED 372 >ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera] Length = 411 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELA +YLLENA D ED Sbjct: 371 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 411 >gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum] Length = 373 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENA-DPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLEN+ D ED Sbjct: 333 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED 373 >ref|XP_011651807.1| PREDICTED: ubiquitin receptor RAD23b [Cucumis sativus] gi|700203513|gb|KGN58646.1| hypothetical protein Csa_3G710740 [Cucumis sativus] Length = 391 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENADPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLEN+ D Sbjct: 351 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFD 390 >emb|CDX81753.1| BnaC08g38480D [Brassica napus] Length = 363 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLEN-ADPED 329 I+RLEAMGFD L IEAFL+C+RNEELAA+YLLEN AD ED Sbjct: 323 IQRLEAMGFDRALVIEAFLACDRNEELAANYLLENSADFED 363 >ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23a [Brassica rapa] gi|674879252|emb|CDY52848.1| BnaA09g56400D [Brassica napus] Length = 359 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLEN-ADPED 329 I+RLEAMGFD L IEAFL+C+RNEELAA+YLLEN AD ED Sbjct: 319 IQRLEAMGFDRALVIEAFLACDRNEELAANYLLENSADFED 359 >ref|XP_008462954.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Cucumis melo] Length = 364 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 448 IERLEAMGFDSILAIEAFLSCNRNEELAASYLLENADPED 329 IERLEAMGFD L IEAFL+C+RNEELAA+YLLEN+ D Sbjct: 324 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFD 363