BLASTX nr result
ID: Cinnamomum23_contig00039636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00039636 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_636342.1| Ycf2 (chloroplast) [Eucalyptus globulus subsp. ... 71 3e-10 ref|YP_008578216.1| Ycf2 (chloroplast) [Stockwellia quadrifida] ... 71 3e-10 ref|YP_008578131.1| Ycf2 (chloroplast) [Allosyncarpia ternata] g... 71 3e-10 ref|YP_008577536.1| Ycf2 (chloroplast) [Eucalyptus erythrocorys]... 71 3e-10 ref|YP_008577451.1| Ycf2 (chloroplast) [Eucalyptus guilfoylei] g... 71 3e-10 ref|YP_008577366.1| Ycf2 (chloroplast) [Eucalyptus microcorys] g... 71 3e-10 ref|YP_008577281.1| Ycf2 (chloroplast) [Eucalyptus salmonophloia... 71 3e-10 ref|YP_008577196.1| Ycf2 (chloroplast) [Eucalyptus diversicolor]... 71 3e-10 ref|YP_008577111.1| Ycf2 (chloroplast) [Eucalyptus torquata] gi|... 71 3e-10 ref|YP_008577026.1| Ycf2 (chloroplast) [Eucalyptus spathulata] g... 71 3e-10 ref|YP_008576941.1| Ycf2 (chloroplast) [Eucalyptus deglupta] gi|... 71 3e-10 ref|YP_008576856.1| Ycf2 (chloroplast) [Eucalyptus camaldulensis... 71 3e-10 ref|YP_008576601.1| Ycf2 (chloroplast) [Eucalyptus nitens] gi|54... 71 3e-10 ref|YP_008576346.1| Ycf2 (chloroplast) [Eucalyptus melliodora] g... 71 3e-10 ref|YP_008576431.1| Ycf2 (chloroplast) [Eucalyptus polybractea] ... 71 3e-10 ref|YP_008576261.1| Ycf2 (chloroplast) [Eucalyptus curtisii] gi|... 71 3e-10 ref|YP_008576176.1| Ycf2 (chloroplast) [Eucalyptus marginata] gi... 71 3e-10 ref|YP_008576091.1| Ycf2 (chloroplast) [Eucalyptus patens] gi|54... 71 3e-10 ref|YP_008575921.1| Ycf2 (chloroplast) [Eucalyptus umbra] gi|545... 71 3e-10 ref|YP_008575581.1| Ycf2 (chloroplast) [Eucalyptus diversifolia]... 71 3e-10 >ref|YP_636342.1| Ycf2 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|108802705|ref|YP_636361.1| Ycf2 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|109896298|sp|Q49KT6.1|YCF2_EUCGG RecName: Full=Protein Ycf2 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|60460850|gb|AAX21070.1| hypothetical chloroplast RF2 (chloroplast) [Eucalyptus globulus subsp. globulus] gi|60460871|gb|AAX21091.1| hypothetical chloroplast RF2 (chloroplast) [Eucalyptus globulus subsp. globulus] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008578216.1| Ycf2 (chloroplast) [Stockwellia quadrifida] gi|545719317|ref|YP_008578235.1| Ycf2 (chloroplast) [Stockwellia quadrifida] gi|442569464|gb|AGC59625.1| Ycf2 (chloroplast) [Stockwellia quadrifida] gi|442569483|gb|AGC59644.1| Ycf2 (chloroplast) [Stockwellia quadrifida] Length = 2274 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008578131.1| Ycf2 (chloroplast) [Allosyncarpia ternata] gi|545719489|ref|YP_008578150.1| Ycf2 (chloroplast) [Allosyncarpia ternata] gi|442569378|gb|AGC59540.1| Ycf2 (chloroplast) [Allosyncarpia ternata] gi|442569397|gb|AGC59559.1| Ycf2 (chloroplast) [Allosyncarpia ternata] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577536.1| Ycf2 (chloroplast) [Eucalyptus erythrocorys] gi|545718715|ref|YP_008577555.1| Ycf2 (chloroplast) [Eucalyptus erythrocorys] gi|442568776|gb|AGC58945.1| Ycf2 (chloroplast) [Eucalyptus erythrocorys] gi|442568795|gb|AGC58964.1| Ycf2 (chloroplast) [Eucalyptus erythrocorys] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577451.1| Ycf2 (chloroplast) [Eucalyptus guilfoylei] gi|545718629|ref|YP_008577470.1| Ycf2 (chloroplast) [Eucalyptus guilfoylei] gi|442568690|gb|AGC58860.1| Ycf2 (chloroplast) [Eucalyptus guilfoylei] gi|442568709|gb|AGC58879.1| Ycf2 (chloroplast) [Eucalyptus guilfoylei] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577366.1| Ycf2 (chloroplast) [Eucalyptus microcorys] gi|545718543|ref|YP_008577385.1| Ycf2 (chloroplast) [Eucalyptus microcorys] gi|442568604|gb|AGC58775.1| Ycf2 (chloroplast) [Eucalyptus microcorys] gi|442568623|gb|AGC58794.1| Ycf2 (chloroplast) [Eucalyptus microcorys] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577281.1| Ycf2 (chloroplast) [Eucalyptus salmonophloia] gi|545718457|ref|YP_008577300.1| Ycf2 (chloroplast) [Eucalyptus salmonophloia] gi|442568518|gb|AGC58690.1| Ycf2 (chloroplast) [Eucalyptus salmonophloia] gi|442568537|gb|AGC58709.1| Ycf2 (chloroplast) [Eucalyptus salmonophloia] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577196.1| Ycf2 (chloroplast) [Eucalyptus diversicolor] gi|545718371|ref|YP_008577215.1| Ycf2 (chloroplast) [Eucalyptus diversicolor] gi|442568432|gb|AGC58605.1| Ycf2 (chloroplast) [Eucalyptus diversicolor] gi|442568451|gb|AGC58624.1| Ycf2 (chloroplast) [Eucalyptus diversicolor] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577111.1| Ycf2 (chloroplast) [Eucalyptus torquata] gi|545718285|ref|YP_008577130.1| Ycf2 (chloroplast) [Eucalyptus torquata] gi|442568346|gb|AGC58520.1| Ycf2 (chloroplast) [Eucalyptus torquata] gi|442568365|gb|AGC58539.1| Ycf2 (chloroplast) [Eucalyptus torquata] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008577026.1| Ycf2 (chloroplast) [Eucalyptus spathulata] gi|545718199|ref|YP_008577045.1| Ycf2 (chloroplast) [Eucalyptus spathulata] gi|442568260|gb|AGC58435.1| Ycf2 (chloroplast) [Eucalyptus spathulata] gi|442568279|gb|AGC58454.1| Ycf2 (chloroplast) [Eucalyptus spathulata] Length = 2287 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576941.1| Ycf2 (chloroplast) [Eucalyptus deglupta] gi|545718113|ref|YP_008576960.1| Ycf2 (chloroplast) [Eucalyptus deglupta] gi|442568174|gb|AGC58350.1| Ycf2 (chloroplast) [Eucalyptus deglupta] gi|442568193|gb|AGC58369.1| Ycf2 (chloroplast) [Eucalyptus deglupta] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576856.1| Ycf2 (chloroplast) [Eucalyptus camaldulensis] gi|545718027|ref|YP_008576875.1| Ycf2 (chloroplast) [Eucalyptus camaldulensis] gi|442568088|gb|AGC58265.1| Ycf2 (chloroplast) [Eucalyptus camaldulensis] gi|442568107|gb|AGC58284.1| Ycf2 (chloroplast) [Eucalyptus camaldulensis] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576601.1| Ycf2 (chloroplast) [Eucalyptus nitens] gi|545717769|ref|YP_008576620.1| Ycf2 (chloroplast) [Eucalyptus nitens] gi|545717836|ref|YP_008576686.1| Ycf2 (chloroplast) [Eucalyptus aromaphloia] gi|545717855|ref|YP_008576705.1| Ycf2 (chloroplast) [Eucalyptus aromaphloia] gi|442567744|gb|AGC57925.1| Ycf2 (chloroplast) [Eucalyptus globulus] gi|442567763|gb|AGC57944.1| Ycf2 (chloroplast) [Eucalyptus globulus] gi|442567830|gb|AGC58010.1| Ycf2 (chloroplast) [Eucalyptus nitens] gi|442567849|gb|AGC58029.1| Ycf2 (chloroplast) [Eucalyptus nitens] gi|442567916|gb|AGC58095.1| Ycf2 (chloroplast) [Eucalyptus aromaphloia] gi|442567935|gb|AGC58114.1| Ycf2 (chloroplast) [Eucalyptus aromaphloia] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576346.1| Ycf2 (chloroplast) [Eucalyptus melliodora] gi|545717511|ref|YP_008576365.1| Ycf2 (chloroplast) [Eucalyptus melliodora] gi|442567486|gb|AGC57670.1| Ycf2 (chloroplast) [Eucalyptus melliodora] gi|442567505|gb|AGC57689.1| Ycf2 (chloroplast) [Eucalyptus melliodora] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576431.1| Ycf2 (chloroplast) [Eucalyptus polybractea] gi|545717597|ref|YP_008576450.1| Ycf2 (chloroplast) [Eucalyptus polybractea] gi|545717664|ref|YP_008576516.1| Ycf2 (chloroplast) [Eucalyptus cladocalyx] gi|545717683|ref|YP_008576535.1| Ycf2 (chloroplast) [Eucalyptus cladocalyx] gi|442567400|gb|AGC57585.1| Ycf2 (chloroplast) [Eucalyptus melliodora] gi|442567419|gb|AGC57604.1| Ycf2 (chloroplast) [Eucalyptus melliodora] gi|442567572|gb|AGC57755.1| Ycf2 (chloroplast) [Eucalyptus polybractea] gi|442567591|gb|AGC57774.1| Ycf2 (chloroplast) [Eucalyptus polybractea] gi|442567658|gb|AGC57840.1| Ycf2 (chloroplast) [Eucalyptus cladocalyx] gi|442567677|gb|AGC57859.1| Ycf2 (chloroplast) [Eucalyptus cladocalyx] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576261.1| Ycf2 (chloroplast) [Eucalyptus curtisii] gi|545717425|ref|YP_008576280.1| Ycf2 (chloroplast) [Eucalyptus curtisii] gi|442567314|gb|AGC57500.1| Ycf2 (chloroplast) [Eucalyptus curtisii] gi|442567333|gb|AGC57519.1| Ycf2 (chloroplast) [Eucalyptus curtisii] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576176.1| Ycf2 (chloroplast) [Eucalyptus marginata] gi|545717339|ref|YP_008576195.1| Ycf2 (chloroplast) [Eucalyptus marginata] gi|442567228|gb|AGC57415.1| Ycf2 (chloroplast) [Eucalyptus marginata] gi|442567247|gb|AGC57434.1| Ycf2 (chloroplast) [Eucalyptus marginata] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008576091.1| Ycf2 (chloroplast) [Eucalyptus patens] gi|545717253|ref|YP_008576110.1| Ycf2 (chloroplast) [Eucalyptus patens] gi|442567142|gb|AGC57330.1| Ycf2 (chloroplast) [Eucalyptus patens] gi|442567161|gb|AGC57349.1| Ycf2 (chloroplast) [Eucalyptus patens] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008575921.1| Ycf2 (chloroplast) [Eucalyptus umbra] gi|545717081|ref|YP_008575940.1| Ycf2 (chloroplast) [Eucalyptus umbra] gi|442566970|gb|AGC57160.1| Ycf2 (chloroplast) [Eucalyptus umbra] gi|442566989|gb|AGC57179.1| Ycf2 (chloroplast) [Eucalyptus umbra] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233 >ref|YP_008575581.1| Ycf2 (chloroplast) [Eucalyptus diversifolia] gi|545716737|ref|YP_008575600.1| Ycf2 (chloroplast) [Eucalyptus diversifolia] gi|442566626|gb|AGC56820.1| Ycf2 (chloroplast) [Eucalyptus diversifolia] gi|442566645|gb|AGC56839.1| Ycf2 (chloroplast) [Eucalyptus diversifolia] Length = 2280 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -3 Query: 153 NYL*KKMDSSCNICNDIVVGI*ITFKEKDVEYMEFLSVSYTDDSICEDRDW 1 N++ KK DSSC I N+ V GI I+FKEKD++Y+EFL V Y DD IC+D DW Sbjct: 183 NWIGKKRDSSCKISNETVAGIEISFKEKDIKYLEFLFVYYMDDPICKDHDW 233