BLASTX nr result
ID: Cinnamomum23_contig00039605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00039605 (659 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010522982.1| PREDICTED: respiratory burst oxidase homolog... 78 5e-12 ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog... 76 1e-11 ref|XP_011015154.1| PREDICTED: respiratory burst oxidase homolog... 74 7e-11 ref|XP_011003531.1| PREDICTED: respiratory burst oxidase homolog... 74 7e-11 ref|XP_011040313.1| PREDICTED: respiratory burst oxidase homolog... 74 7e-11 ref|XP_002318793.2| respiratory burst oxidase C family protein [... 74 7e-11 ref|XP_002322314.2| respiratory burst oxidase C family protein [... 74 7e-11 ref|XP_010530642.1| PREDICTED: respiratory burst oxidase homolog... 74 9e-11 ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog... 74 9e-11 ref|XP_009421001.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_009404717.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_009404716.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_010657584.1| PREDICTED: respiratory burst oxidase homolog... 73 2e-10 ref|XP_009404193.1| PREDICTED: respiratory burst oxidase homolog... 73 2e-10 emb|CBI29288.3| unnamed protein product [Vitis vinifera] 73 2e-10 gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] 73 2e-10 gb|KJB51327.1| hypothetical protein B456_008G212100 [Gossypium r... 72 2e-10 gb|KJB51325.1| hypothetical protein B456_008G212100 [Gossypium r... 72 2e-10 ref|XP_012439086.1| PREDICTED: respiratory burst oxidase homolog... 72 2e-10 ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog... 72 2e-10 >ref|XP_010522982.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya hassleriana] Length = 945 Score = 77.8 bits (190), Expect = 5e-12 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG G TKELRQLA DFSHRTSTKFDFHKENF Sbjct: 904 HADSRVGVFYCGAPGLTKELRQLALDFSHRTSTKFDFHKENF 945 >ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo nucifera] Length = 926 Score = 76.3 bits (186), Expect = 1e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H++ RVGVFYCG PTKELRQLA DFSH+TSTKFDFHKENF Sbjct: 885 HQNARVGVFYCGAPAPTKELRQLASDFSHKTSTKFDFHKENF 926 >ref|XP_011015154.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus euphratica] Length = 909 Score = 73.9 bits (180), Expect = 7e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 868 HPDSRVGVFYCGAPALTKELRQLALDFSHKTSTKFDFHKENF 909 >ref|XP_011003531.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus euphratica] Length = 909 Score = 73.9 bits (180), Expect = 7e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 868 HPDSRVGVFYCGAPALTKELRQLALDFSHKTSTKFDFHKENF 909 >ref|XP_011040313.1| PREDICTED: respiratory burst oxidase homolog protein C [Populus euphratica] Length = 909 Score = 73.9 bits (180), Expect = 7e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 868 HPDSRVGVFYCGAPALTKELRQLALDFSHKTSTKFDFHKENF 909 >ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550326872|gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 909 Score = 73.9 bits (180), Expect = 7e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 868 HPDSRVGVFYCGAPALTKELRQLALDFSHKTSTKFDFHKENF 909 >ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa] gi|550322544|gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa] Length = 915 Score = 73.9 bits (180), Expect = 7e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 874 HPDSRVGVFYCGAPALTKELRQLALDFSHKTSTKFDFHKENF 915 >ref|XP_010530642.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya hassleriana] Length = 929 Score = 73.6 bits (179), Expect = 9e-11 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELR LA DFSHRTSTKFDFHKENF Sbjct: 888 HADSRVGVFYCGAPALTKELRHLALDFSHRTSTKFDFHKENF 929 >ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Nelumbo nucifera] Length = 924 Score = 73.6 bits (179), Expect = 9e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 883 HGDARVGVFYCGAPALTKELRQLALDFSHKTSTKFDFHKENF 924 >ref|XP_009421001.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa acuminata subsp. malaccensis] Length = 940 Score = 73.2 bits (178), Expect = 1e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 HRD+R+GVFYCG TKELRQLA DFS +TSTKFDFHKENF Sbjct: 899 HRDQRIGVFYCGAPTLTKELRQLATDFSRKTSTKFDFHKENF 940 >ref|XP_009404717.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 926 Score = 73.2 bits (178), Expect = 1e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 HRD+R+GVFYCG TKELRQLA DFS +TSTKFDFHKENF Sbjct: 885 HRDQRIGVFYCGAPTLTKELRQLATDFSRKTSTKFDFHKENF 926 >ref|XP_009404716.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 938 Score = 73.2 bits (178), Expect = 1e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 HRD+R+GVFYCG TKELRQLA DFS +TSTKFDFHKENF Sbjct: 897 HRDQRIGVFYCGAPTLTKELRQLATDFSRKTSTKFDFHKENF 938 >ref|XP_010657584.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis vinifera] gi|731377437|ref|XP_010657595.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis vinifera] Length = 923 Score = 72.8 bits (177), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TK+LRQLA DFSHRT+TKFDFHKENF Sbjct: 882 HPDSRVGVFYCGAPALTKDLRQLALDFSHRTTTKFDFHKENF 923 >ref|XP_009404193.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa acuminata subsp. malaccensis] Length = 938 Score = 72.8 bits (177), Expect = 2e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 HR++R+GVFYCG TKELRQLA DF+H+T+TKFDFHKENF Sbjct: 897 HREKRIGVFYCGAPALTKELRQLAQDFTHKTTTKFDFHKENF 938 >emb|CBI29288.3| unnamed protein product [Vitis vinifera] Length = 827 Score = 72.8 bits (177), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TK+LRQLA DFSHRT+TKFDFHKENF Sbjct: 786 HPDSRVGVFYCGAPALTKDLRQLALDFSHRTTTKFDFHKENF 827 >gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] Length = 887 Score = 72.8 bits (177), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H + RVGVFYCG P KELRQLA DFSH+TSTKFDFHKENF Sbjct: 846 HPETRVGVFYCGAPPPVKELRQLASDFSHKTSTKFDFHKENF 887 >gb|KJB51327.1| hypothetical protein B456_008G212100 [Gossypium raimondii] Length = 888 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H + RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 847 HNNSRVGVFYCGAPALTKELRQLASDFSHKTSTKFDFHKENF 888 >gb|KJB51325.1| hypothetical protein B456_008G212100 [Gossypium raimondii] Length = 634 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H + RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 593 HNNSRVGVFYCGAPALTKELRQLASDFSHKTSTKFDFHKENF 634 >ref|XP_012439086.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Gossypium raimondii] gi|763784252|gb|KJB51323.1| hypothetical protein B456_008G212100 [Gossypium raimondii] Length = 918 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H + RVGVFYCG TKELRQLA DFSH+TSTKFDFHKENF Sbjct: 877 HNNSRVGVFYCGAPALTKELRQLASDFSHKTSTKFDFHKENF 918 >ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D [Fragaria vesca subsp. vesca] Length = 935 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 658 HRDERVGVFYCGNVGPTKELRQLAWDFSHRTSTKFDFHKENF 533 H D RVGVFYCG TKEL+QLA DFSHRTSTKF+FHKENF Sbjct: 894 HPDSRVGVFYCGAPALTKELKQLALDFSHRTSTKFEFHKENF 935