BLASTX nr result
ID: Cinnamomum23_contig00039201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00039201 (360 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003192603.1| cation transport-related protein [Cryptococc... 62 2e-07 gb|KIR48057.1| plasma membrane proteolipid 3 [Cryptococcus gatti... 62 2e-07 ref|XP_003867923.1| hypothetical protein CORT_0B07810 [Candida o... 60 6e-07 ref|XP_007372289.1| hypothetical protein SPAPADRAFT_57975 [Spath... 60 7e-07 ref|XP_776234.1| hypothetical protein CNBC6250 [Cryptococcus neo... 59 1e-06 ref|XP_569421.1| cation transport-related protein [Cryptococcus ... 59 1e-06 emb|CCE40621.1| hypothetical protein CPAR2_106560 [Candida parap... 59 2e-06 gb|EIE76530.1| plasma membrane proteolipid 3 [Rhizopus delemar R... 58 2e-06 ref|XP_006689943.1| UPF0057-domain-containing protein [Candida t... 57 4e-06 gb|KLT38918.1| cation transport-related protein [Trichosporon ol... 57 5e-06 emb|CDI50937.1| conserved hypothetical protein [Melanopsichium p... 56 8e-06 gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium ... 56 8e-06 emb|CBQ67374.1| conserved hypothetical protein [Sporisorium reil... 56 8e-06 >ref|XP_003192603.1| cation transport-related protein [Cryptococcus gattii WM276] gi|799342862|ref|XP_012052623.1| plasma membrane proteolipid 3 [Cryptococcus neoformans var. grubii H99] gi|317459072|gb|ADV20816.1| cation transport-related protein, putative [Cryptococcus gattii WM276] gi|405123028|gb|AFR97793.1| plasma membrane proteolipid 3 [Cryptococcus neoformans var. grubii H99] gi|686627047|gb|KGB78289.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii R265] gi|757321961|gb|KIR28043.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii LA55] gi|757326556|gb|KIR32612.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii MMRL2647] gi|757333751|gb|KIR39782.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii Ram5] gi|757349541|gb|KIR55398.1| plasma membrane proteolipid 3 [Cryptococcus gattii Ru294] gi|757364862|gb|KIR70669.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii CA1014] gi|757376889|gb|KIR82304.1| plasma membrane proteolipid 3 [Cryptococcus gattii EJB2] gi|757381590|gb|KIR86938.1| plasma membrane proteolipid 3 [Cryptococcus gattii IND107] gi|757385422|gb|KIR90752.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii CBS 10090] gi|757392204|gb|KIR97508.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii 2001/935-1] gi|761744796|gb|KIY33333.1| plasma membrane proteolipid 3 [Cryptococcus gattii E566] gi|761937142|gb|KIY57931.1| plasma membrane proteolipid 3, partial [Cryptococcus gattii 99/473] gi|765281120|gb|KJE03659.1| plasma membrane proteolipid 3 [Cryptococcus gattii NT-10] Length = 57 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MA TCSDI K+I A+ILPPLGVFLE+ C+ DFLI+ILLTIL Sbjct: 1 MAFTCSDIFKIILAIILPPLGVFLER-GCNADFLINILLTIL 41 >gb|KIR48057.1| plasma membrane proteolipid 3 [Cryptococcus gattii CA1280] gi|757363751|gb|KIR69567.1| plasma membrane proteolipid 3 [Cryptococcus gattii CA1873] Length = 57 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MA TCSDI K+I A+ILPPLGVFLE+ C+ DFLI+ILLTIL Sbjct: 1 MAFTCSDIFKIILAIILPPLGVFLER-GCNVDFLINILLTIL 41 >ref|XP_003867923.1| hypothetical protein CORT_0B07810 [Candida orthopsilosis Co 90-125] gi|380352262|emb|CCG22486.1| hypothetical protein CORT_0B07810 [Candida orthopsilosis] Length = 57 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 M TCSDIIK+IAA+ILPPLGVFLE C+ F ISILLTIL Sbjct: 1 MPFTCSDIIKIIAAIILPPLGVFLE-TGCNSSFFISILLTIL 41 >ref|XP_007372289.1| hypothetical protein SPAPADRAFT_57975 [Spathaspora passalidarum NRRL Y-27907] gi|344304645|gb|EGW34877.1| hypothetical protein SPAPADRAFT_57975 [Spathaspora passalidarum NRRL Y-27907] Length = 57 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MAVTCSDI K+IAAVILPPLGVFLE+ C F ++ILLTIL Sbjct: 1 MAVTCSDIFKIIAAVILPPLGVFLER-GCVGSFFLNILLTIL 41 >ref|XP_776234.1| hypothetical protein CNBC6250 [Cryptococcus neoformans var. neoformans B-3501A] gi|50258906|gb|EAL21587.1| hypothetical protein CNBC6250 [Cryptococcus neoformans var. neoformans B-3501A] Length = 70 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MA TCSDI K+I A+ILPPLGVFLE+ C D LI+ILLTIL Sbjct: 1 MAFTCSDIFKIILAIILPPLGVFLER-GCGADLLINILLTIL 41 >ref|XP_569421.1| cation transport-related protein [Cryptococcus neoformans var. neoformans JEC21] gi|338819203|sp|P0CS19.1|PMP3_CRYNB RecName: Full=Plasma membrane proteolipid 3 [Cryptococcus neoformans var. neoformans B-3501A] gi|338819204|sp|P0CS18.1|PMP3_CRYNJ RecName: Full=Plasma membrane proteolipid 3 gi|57225653|gb|AAW42114.1| cation transport-related protein, putative [Cryptococcus neoformans var. neoformans JEC21] Length = 57 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MA TCSDI K+I A+ILPPLGVFLE+ C D LI+ILLTIL Sbjct: 1 MAFTCSDIFKIILAIILPPLGVFLER-GCGADLLINILLTIL 41 >emb|CCE40621.1| hypothetical protein CPAR2_106560 [Candida parapsilosis] Length = 57 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 M TCSDIIK+IAA+ILPPLGVF+E C+ F ISI+LTIL Sbjct: 1 MPFTCSDIIKIIAAIILPPLGVFME-TGCNSSFFISIILTIL 41 >gb|EIE76530.1| plasma membrane proteolipid 3 [Rhizopus delemar RA 99-880] Length = 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MA T SDIIK+I A++LPPLGVFLE+ C+ DFLI+I LTIL Sbjct: 1 MATTASDIIKIIGAIVLPPLGVFLER-GCNVDFLINIALTIL 41 >ref|XP_006689943.1| UPF0057-domain-containing protein [Candida tenuis ATCC 10573] gi|344228843|gb|EGV60729.1| UPF0057-domain-containing protein [Candida tenuis ATCC 10573] Length = 57 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 MAVTCSDI KLI A+ILPPLGVFLE+ C I+I+LTIL Sbjct: 1 MAVTCSDIFKLIFAIILPPLGVFLER-GCSSSLFINIILTIL 41 >gb|KLT38918.1| cation transport-related protein [Trichosporon oleaginosus] Length = 56 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 M TCSDIIK+I A+ILPPLGVFLE+ C D LI+ILLT L Sbjct: 1 MPATCSDIIKIILAIILPPLGVFLER-GCGADLLINILLTCL 41 >emb|CDI50937.1| conserved hypothetical protein [Melanopsichium pennsylvanicum 4] Length = 57 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 M TCSDI+K+I A+ LPPLGVFLE+ C DF I++LLTIL Sbjct: 1 MPFTCSDIVKIILAIFLPPLGVFLER-GCGADFWINVLLTIL 41 >gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 57 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 M T SDIIK+I A+ILPPLGVFLE+ C DFLI+ILLTIL Sbjct: 1 MPFTGSDIIKIILAIILPPLGVFLER-GCGADFLINILLTIL 41 >emb|CBQ67374.1| conserved hypothetical protein [Sporisorium reilianum SRZ2] gi|388852536|emb|CCF53699.1| uncharacterized protein UHOR_00047 [Ustilago hordei] Length = 57 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 258 MAVTCSDIIKLIAAVILPPLGVFLEKEACDKDFLISILLTIL 133 M TCSDI+K+I A+ LPPLGVFLE+ C DF I++LLTIL Sbjct: 1 MPFTCSDIVKIILAIFLPPLGVFLER-GCGADFWINVLLTIL 41