BLASTX nr result
ID: Cinnamomum23_contig00038974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00038974 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008243706.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_007215672.1| hypothetical protein PRUPE_ppa003913mg [Prun... 75 1e-11 ref|XP_010936927.1| PREDICTED: putative pentatricopeptide repeat... 73 6e-11 ref|XP_008797358.1| PREDICTED: putative pentatricopeptide repeat... 70 4e-10 ref|XP_009362516.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 ref|XP_008377650.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 emb|CBI27814.3| unnamed protein product [Vitis vinifera] 66 1e-08 ref|XP_002278128.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_010320212.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_011466751.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_006338058.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_009614402.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 ref|XP_009404166.1| PREDICTED: putative pentatricopeptide repeat... 56 8e-06 >ref|XP_008243706.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Prunus mume] Length = 577 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -2 Query: 165 SLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 SL +N NSCSSF DLKC+HA I HG +QNLLL+TKL+ LA AP MDYA K Sbjct: 30 SLPFNYFFNSCSSFSDLKCIHALIFQHGSNQNLLLSTKLVTLASSMAPTMDYARK 84 >ref|XP_007215672.1| hypothetical protein PRUPE_ppa003913mg [Prunus persica] gi|462411822|gb|EMJ16871.1| hypothetical protein PRUPE_ppa003913mg [Prunus persica] Length = 540 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -2 Query: 165 SLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 SL +N NSCSSF DLKC+HA I HG +QNLLL+TKL+ LA AP MDYA K Sbjct: 30 SLPFNYFFNSCSSFSDLKCIHALIFQHGSNQNLLLSTKLVTLASSMAPTMDYARK 84 >ref|XP_010936927.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Elaeis guineensis] Length = 599 Score = 73.2 bits (178), Expect = 6e-11 Identities = 38/68 (55%), Positives = 45/68 (66%), Gaps = 9/68 (13%) Frame = -2 Query: 177 SFPPSLY---------YNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFA 25 SFPPSL +N+ LNSCSS L+C+HA ILT GLS +L LATKLI+LA + Sbjct: 12 SFPPSLLLRTNCRSLPFNDFLNSCSSLSALQCLHAHILTQGLSHHLALATKLISLAAALS 71 Query: 24 PAMDYAHK 1 P MDYA K Sbjct: 72 PTMDYARK 79 >ref|XP_008797358.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Phoenix dactylifera] Length = 589 Score = 70.5 bits (171), Expect = 4e-10 Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 9/68 (13%) Frame = -2 Query: 177 SFPPSLY---------YNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFA 25 SFPPSL +N+ LNSCSS L+C+HA+ILT GLS +L LATKLI++A + Sbjct: 12 SFPPSLLLRTNCHSLPFNDFLNSCSSVSALQCLHARILTQGLSHHLALATKLISIASALS 71 Query: 24 PAMDYAHK 1 P +DYA K Sbjct: 72 PTIDYARK 79 >ref|XP_009362516.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] gi|694368698|ref|XP_009362518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] gi|694368783|ref|XP_009362544.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] gi|694368786|ref|XP_009362545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Pyrus x bretschneideri] Length = 595 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = -2 Query: 162 LYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 L +N LNSCSS +LKC+HA I HG +Q+LLL+TKL+ LA AP MDYA K Sbjct: 31 LSFNYFLNSCSSLSNLKCIHALIFQHGSNQSLLLSTKLVTLASSLAPTMDYAQK 84 >ref|XP_008377650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Malus domestica] gi|657971720|ref|XP_008377651.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Malus domestica] Length = 595 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/54 (59%), Positives = 39/54 (72%) Frame = -2 Query: 162 LYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 L +N LNSCSS +LKC+HA I HG +Q+LLL+TKL+ LA AP MDYA K Sbjct: 31 LSFNYFLNSCSSLSNLKCIHALIFQHGSNQSLLLSTKLVTLASSLAPTMDYARK 84 >emb|CBI27814.3| unnamed protein product [Vitis vinifera] Length = 555 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 156 YNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 +N LLN CSS DL +HA ++T+G QNLLL+TKLI AC AP MDYA K Sbjct: 32 FNYLLNCCSSLPDLSRIHALVVTNGCGQNLLLSTKLIITACCLAPTMDYARK 83 >ref|XP_002278128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290 [Vitis vinifera] Length = 597 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 156 YNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 +N LLN CSS DL +HA ++T+G QNLLL+TKLI AC AP MDYA K Sbjct: 32 FNYLLNCCSSLPDLSRIHALVVTNGCGQNLLLSTKLIITACCLAPTMDYARK 83 >ref|XP_010320212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 606 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 10/82 (12%) Frame = -2 Query: 216 LQKLLLRRTDLF----------LSFPPSLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNL 67 L+KLL + LF ++ P L++ +LL+SC S LK +H +LT G +NL Sbjct: 6 LRKLLSKFESLFTIPFDLSTSAIADHPFLHFTHLLSSCHSLPALKQLHTLVLTTGYHKNL 65 Query: 66 LLATKLIALACGFAPAMDYAHK 1 L+ TK+++LAC +P MDYA K Sbjct: 66 LICTKIVSLACFLSPTMDYARK 87 >ref|XP_011466751.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] gi|764602890|ref|XP_011466752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] gi|764602894|ref|XP_004305327.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 596 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 165 SLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDY 10 SL N++L SCSS DLKC+HA+ + G QNL L TKL++LA AP MDY Sbjct: 30 SLPLNHILQSCSSLSDLKCIHAKTIKAGYYQNLPLTTKLVSLASCMAPTMDY 81 >ref|XP_006338058.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 608 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = -2 Query: 168 PSLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 P L+++ LL+SC S LK +H +LT G +NLL+ TK+++L C +P MDYA K Sbjct: 32 PFLHFSYLLSSCHSLPALKQLHTLVLTTGYHKNLLICTKIVSLGCFLSPTMDYARK 87 >ref|XP_009614402.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Nicotiana tomentosiformis] Length = 613 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/56 (51%), Positives = 36/56 (64%) Frame = -2 Query: 168 PSLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 P L ++ LLNSC S LK +HA LT G NL + TKL++LAC +P MDYA K Sbjct: 32 PFLPFSYLLNSCHSLAALKRLHALALTTGYLTNLPVCTKLVSLACFLSPTMDYARK 87 >ref|XP_009404166.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g05240 [Musa acuminata subsp. malaccensis] Length = 616 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -2 Query: 165 SLYYNNLLNSCSSFQDLKCVHAQILTHGLSQNLLLATKLIALACGFAPAMDYAHK 1 S+ Y L +S SS LKC+HA +L GL+ L LATKL++LA +PA+DYA K Sbjct: 33 SVPYRRLSDSISSLPALKCLHAVVLKEGLAHRLPLATKLLSLAVSLSPAVDYARK 87