BLASTX nr result
ID: Cinnamomum23_contig00038830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00038830 (210 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG19082.1| Putative disease resistance RGA4 [Gossypium arbor... 92 1e-16 ref|XP_008804945.1| PREDICTED: putative disease resistance prote... 92 1e-16 gb|KJB46385.1| hypothetical protein B456_007G364400 [Gossypium r... 91 2e-16 ref|XP_012435050.1| PREDICTED: putative disease resistance prote... 91 3e-16 gb|KJB46403.1| hypothetical protein B456_007G365900 [Gossypium r... 91 3e-16 ref|XP_012435032.1| PREDICTED: putative disease resistance prote... 91 4e-16 gb|KJB46394.1| hypothetical protein B456_007G365300 [Gossypium r... 91 4e-16 ref|XP_012435025.1| PREDICTED: putative disease resistance prote... 90 7e-16 ref|XP_012435023.1| PREDICTED: putative disease resistance prote... 90 7e-16 gb|KJB46398.1| hypothetical protein B456_007G365500 [Gossypium r... 90 7e-16 ref|XP_009368061.1| PREDICTED: disease resistance protein RGA2-l... 89 9e-16 emb|CDP11750.1| unnamed protein product [Coffea canephora] 89 1e-15 gb|KJB46395.1| hypothetical protein B456_007G365400 [Gossypium r... 89 1e-15 gb|KJB46384.1| hypothetical protein B456_007G364300 [Gossypium r... 88 2e-15 emb|CDP21238.1| unnamed protein product [Coffea canephora] 88 2e-15 ref|XP_008375181.1| PREDICTED: putative disease resistance prote... 88 2e-15 ref|XP_012435046.1| PREDICTED: putative disease resistance prote... 88 3e-15 ref|XP_012435041.1| PREDICTED: putative disease resistance prote... 88 3e-15 ref|XP_012435038.1| PREDICTED: putative disease resistance prote... 88 3e-15 gb|KJB46382.1| hypothetical protein B456_007G364100 [Gossypium r... 88 3e-15 >gb|KHG19082.1| Putative disease resistance RGA4 [Gossypium arboreum] Length = 721 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/67 (67%), Positives = 54/67 (80%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LREK+ GK+YLLVLDD+WNE+ E W SL+ LL+ G +GSRI+VTTRS KVA I SK QPY Sbjct: 8 LREKIGGKKYLLVLDDIWNEERENWVSLKELLIGGAKGSRIIVTTRSFKVAKITSKCQPY 67 Query: 24 SLKPLSE 4 LK LS+ Sbjct: 68 VLKGLSD 74 >ref|XP_008804945.1| PREDICTED: putative disease resistance protein RGA3 [Phoenix dactylifera] Length = 979 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 L++KL+GKRYLLVLDDVWNE+ E+W LR LLCG RGS+I+VTTRS +VA+IMS PY Sbjct: 263 LKKKLAGKRYLLVLDDVWNEETEQWERLRVPLLCGARGSKILVTTRSEEVANIMSTSSPY 322 Query: 24 SLKPLSED 1 SL L +D Sbjct: 323 SLGGLLDD 330 >gb|KJB46385.1| hypothetical protein B456_007G364400 [Gossypium raimondii] Length = 1121 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/68 (64%), Positives = 55/68 (80%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LREK+ GK+YLLVLDD+WN++ EKW SL+ LL+ G +GSRI+VTTRS KVA I SK QPY Sbjct: 263 LREKIGGKKYLLVLDDIWNDEWEKWVSLKELLVGGAKGSRIIVTTRSSKVAKITSKCQPY 322 Query: 24 SLKPLSED 1 L LS++ Sbjct: 323 VLNGLSDN 330 >ref|XP_012435050.1| PREDICTED: putative disease resistance protein RGA3 [Gossypium raimondii] Length = 651 Score = 90.9 bits (224), Expect = 3e-16 Identities = 45/68 (66%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LREK+ GK+YLLVLDD+WNEK E W SL+ LL+ G +GSRI+VTTRS VA I SK QPY Sbjct: 265 LREKIGGKKYLLVLDDIWNEKWENWVSLKELLVGGAKGSRIIVTTRSLGVAKITSKCQPY 324 Query: 24 SLKPLSED 1 LK LS++ Sbjct: 325 VLKGLSDN 332 >gb|KJB46403.1| hypothetical protein B456_007G365900 [Gossypium raimondii] Length = 1286 Score = 90.9 bits (224), Expect = 3e-16 Identities = 45/68 (66%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LREK+ GK+YLLVLDD+WNEK E W SL+ LL+ G +GSRI+VTTRS VA I SK QPY Sbjct: 265 LREKIGGKKYLLVLDDIWNEKWENWVSLKELLVGGAKGSRIIVTTRSLGVAKITSKCQPY 324 Query: 24 SLKPLSED 1 LK LS++ Sbjct: 325 VLKGLSDN 332 >ref|XP_012435032.1| PREDICTED: putative disease resistance protein RGA3 [Gossypium raimondii] Length = 1001 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/68 (64%), Positives = 55/68 (80%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR K+ GK+YLLVLDD+WNE+ E+W SL+ LL+ G +GSRI+VTTRS +VA I SK QPY Sbjct: 111 LRGKIGGKKYLLVLDDIWNEEWEEWVSLKELLVGGAKGSRIIVTTRSLRVAKITSKCQPY 170 Query: 24 SLKPLSED 1 LK LS+D Sbjct: 171 VLKGLSDD 178 >gb|KJB46394.1| hypothetical protein B456_007G365300 [Gossypium raimondii] Length = 1138 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/68 (64%), Positives = 55/68 (80%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR K+ GK+YLLVLDD+WNE+ E+W SL+ LL+ G +GSRI+VTTRS +VA I SK QPY Sbjct: 248 LRGKIGGKKYLLVLDDIWNEEWEEWVSLKELLVGGAKGSRIIVTTRSLRVAKITSKCQPY 307 Query: 24 SLKPLSED 1 LK LS+D Sbjct: 308 VLKGLSDD 315 >ref|XP_012435025.1| PREDICTED: putative disease resistance protein RGA4 isoform X2 [Gossypium raimondii] Length = 987 Score = 89.7 bits (221), Expect = 7e-16 Identities = 43/68 (63%), Positives = 56/68 (82%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR+++ GK+YLLVLDD+WNE+ E+W SL+ LL+ G +GSRI+VTTRS KVA I SK QP+ Sbjct: 81 LRDEIRGKKYLLVLDDIWNEEWEQWVSLKKLLMGGAKGSRIIVTTRSLKVAKITSKCQPH 140 Query: 24 SLKPLSED 1 LK LS+D Sbjct: 141 VLKGLSDD 148 >ref|XP_012435023.1| PREDICTED: putative disease resistance protein RGA4 isoform X1 [Gossypium raimondii] gi|823199797|ref|XP_012435024.1| PREDICTED: putative disease resistance protein RGA4 isoform X1 [Gossypium raimondii] Length = 1167 Score = 89.7 bits (221), Expect = 7e-16 Identities = 43/68 (63%), Positives = 56/68 (82%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR+++ GK+YLLVLDD+WNE+ E+W SL+ LL+ G +GSRI+VTTRS KVA I SK QP+ Sbjct: 261 LRDEIRGKKYLLVLDDIWNEEWEQWVSLKKLLMGGAKGSRIIVTTRSLKVAKITSKCQPH 320 Query: 24 SLKPLSED 1 LK LS+D Sbjct: 321 VLKGLSDD 328 >gb|KJB46398.1| hypothetical protein B456_007G365500 [Gossypium raimondii] Length = 1169 Score = 89.7 bits (221), Expect = 7e-16 Identities = 43/68 (63%), Positives = 56/68 (82%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR+++ GK+YLLVLDD+WNE+ E+W SL+ LL+ G +GSRI+VTTRS KVA I SK QP+ Sbjct: 263 LRDEIRGKKYLLVLDDIWNEEWEQWVSLKKLLMGGAKGSRIIVTTRSLKVAKITSKCQPH 322 Query: 24 SLKPLSED 1 LK LS+D Sbjct: 323 VLKGLSDD 330 >ref|XP_009368061.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri] Length = 1131 Score = 89.4 bits (220), Expect = 9e-16 Identities = 42/67 (62%), Positives = 54/67 (80%) Frame = -1 Query: 201 REKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPYS 22 REK+ GK+YLLVLDDVWNE EKW SL+ LL+ GE GSRI++TTRS+ VA+I +PY+ Sbjct: 256 REKVDGKKYLLVLDDVWNEDREKWLSLKNLLVGGEEGSRILITTRSKTVATISDTAKPYT 315 Query: 21 LKPLSED 1 LK L+E+ Sbjct: 316 LKGLNEE 322 >emb|CDP11750.1| unnamed protein product [Coffea canephora] Length = 1004 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/68 (60%), Positives = 50/68 (73%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LRE L GKRYL+VLDDVWNE P +W ++ +L CG RGS IVVTTR +KVA IM ++ + Sbjct: 254 LRELLRGKRYLIVLDDVWNENPREWEKMKSVLQCGSRGSSIVVTTRKKKVAEIMRTLETH 313 Query: 24 SLKPLSED 1 L LSED Sbjct: 314 YLSSLSED 321 >gb|KJB46395.1| hypothetical protein B456_007G365400 [Gossypium raimondii] Length = 1097 Score = 88.6 bits (218), Expect = 1e-15 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR+K+SG +YLLVLDD+WNE+ E W SL+ LL+ G +GSRI++TTRS KVA I S QP+ Sbjct: 265 LRDKISGIKYLLVLDDIWNEEREAWLSLKNLLMGGAKGSRIIITTRSMKVAKITSTCQPH 324 Query: 24 SLKPLSED 1 LK LS+D Sbjct: 325 VLKVLSDD 332 >gb|KJB46384.1| hypothetical protein B456_007G364300 [Gossypium raimondii] Length = 874 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LREK+ G++YLLVLDD+WN++ EKW L+ LL+ G +GSRI+VTTRS KVA I SK QPY Sbjct: 259 LREKIGGRKYLLVLDDIWNDEWEKWVRLKELLVGGAKGSRIIVTTRSSKVAKITSKCQPY 318 Query: 24 SLKPLSED 1 L LS++ Sbjct: 319 VLNGLSDN 326 >emb|CDP21238.1| unnamed protein product [Coffea canephora] Length = 904 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/68 (60%), Positives = 50/68 (73%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 L+E L GKRYL+VLDDVWNE PE+W L+ +L CG +GS IV TTR KVA+IM +Q Y Sbjct: 227 LQELLRGKRYLIVLDDVWNENPEEWEKLKSVLQCGSKGSSIVTTTRMEKVATIMGTLQTY 286 Query: 24 SLKPLSED 1 L LSE+ Sbjct: 287 YLSSLSEN 294 >ref|XP_008375181.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica] Length = 936 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/68 (58%), Positives = 55/68 (80%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LR+K+ GK+YLLVLDDVWNE EKW SL+ LL+CG +GSRI++TTRS VA+I +PY Sbjct: 139 LRKKVDGKKYLLVLDDVWNEDQEKWLSLKYLLMCGGKGSRILITTRSETVATISDTAKPY 198 Query: 24 SLKPLSED 1 +L+ L+++ Sbjct: 199 TLRGLNKE 206 >ref|XP_012435046.1| PREDICTED: putative disease resistance protein RGA3 isoform X4 [Gossypium raimondii] Length = 878 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LRE + GK+YLLVLDD+WNE+ EKW L+ LL+ G +GSRI+VTTRS +VA I SK QPY Sbjct: 263 LREIIGGKKYLLVLDDIWNEEWEKWVRLKELLVGGAKGSRIIVTTRSLRVAKITSKCQPY 322 Query: 24 SLKPLSED 1 LK LS++ Sbjct: 323 VLKGLSDN 330 >ref|XP_012435041.1| PREDICTED: putative disease resistance protein RGA3 isoform X3 [Gossypium raimondii] Length = 878 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LRE + GK+YLLVLDD+WNE+ EKW L+ LL+ G +GSRI+VTTRS +VA I SK QPY Sbjct: 263 LREIIGGKKYLLVLDDIWNEEWEKWVRLKELLVGGAKGSRIIVTTRSLRVAKITSKCQPY 322 Query: 24 SLKPLSED 1 LK LS++ Sbjct: 323 VLKGLSDN 330 >ref|XP_012435038.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 [Gossypium raimondii] gi|823199847|ref|XP_012435039.1| PREDICTED: putative disease resistance protein RGA3 isoform X2 [Gossypium raimondii] gi|823199853|ref|XP_012435042.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 [Gossypium raimondii] gi|823199856|ref|XP_012435043.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 [Gossypium raimondii] gi|823199859|ref|XP_012435044.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 [Gossypium raimondii] gi|823199862|ref|XP_012435045.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 [Gossypium raimondii] Length = 878 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LRE + GK+YLLVLDD+WNE+ EKW L+ LL+ G +GSRI+VTTRS +VA I SK QPY Sbjct: 263 LREIIGGKKYLLVLDDIWNEEWEKWVRLKELLVGGAKGSRIIVTTRSLRVAKITSKCQPY 322 Query: 24 SLKPLSED 1 LK LS++ Sbjct: 323 VLKGLSDN 330 >gb|KJB46382.1| hypothetical protein B456_007G364100 [Gossypium raimondii] Length = 1138 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = -1 Query: 204 LREKLSGKRYLLVLDDVWNEKPEKWHSLRGLLLCGERGSRIVVTTRSRKVASIMSKIQPY 25 LRE + GK+YLLVLDD+WNE+ EKW L+ LL+ G +GSRI+VTTRS +VA I SK QPY Sbjct: 263 LREIIGGKKYLLVLDDIWNEEWEKWVRLKELLVGGAKGSRIIVTTRSLRVAKITSKCQPY 322 Query: 24 SLKPLSED 1 LK LS++ Sbjct: 323 VLKGLSDN 330