BLASTX nr result
ID: Cinnamomum23_contig00038563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00038563 (425 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago ... 80 7e-13 >ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago truncatula] gi|657370785|gb|KEH16846.1| hypothetical protein MTR_0082s0050 [Medicago truncatula] Length = 334 Score = 79.7 bits (195), Expect = 7e-13 Identities = 41/56 (73%), Positives = 42/56 (75%) Frame = +1 Query: 253 GPEFRPDQTLLCLSCSHAPLQHRGRKISGPGLDKYVEIFVGPGREYQSIFSRIPYH 420 GP DQTLL LSCSHA R +S PGLDKYVEIFVGPGRE QSIFSRIPYH Sbjct: 143 GPGLNSDQTLLYLSCSHA---RRPEDLSCPGLDKYVEIFVGPGRESQSIFSRIPYH 195