BLASTX nr result
ID: Cinnamomum23_contig00037826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00037826 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009377754.1| PREDICTED: CBS domain-containing protein CBS... 59 2e-06 gb|KDO59777.1| hypothetical protein CISIN_1g026712mg [Citrus sin... 58 2e-06 ref|XP_009108754.1| PREDICTED: CBS domain-containing protein CBS... 58 3e-06 emb|CDY51959.1| BnaA08g11590D [Brassica napus] 58 3e-06 emb|CDY62720.1| BnaC03g77200D [Brassica napus] 58 3e-06 ref|XP_012469567.1| PREDICTED: CBS domain-containing protein CBS... 57 4e-06 ref|XP_012469566.1| PREDICTED: CBS domain-containing protein CBS... 57 4e-06 ref|XP_012469568.1| PREDICTED: CBS domain-containing protein CBS... 57 4e-06 emb|CDO97202.1| unnamed protein product [Coffea canephora] 57 5e-06 ref|XP_008348530.1| PREDICTED: CBS domain-containing protein CBS... 57 5e-06 ref|XP_008236486.1| PREDICTED: CBS domain-containing protein CBS... 57 5e-06 ref|XP_007201268.1| hypothetical protein PRUPE_ppa010834mg [Prun... 57 5e-06 ref|XP_007047343.1| Cystathionine beta-synthase family protein i... 57 6e-06 ref|XP_007047342.1| Cystathionine beta-synthase family protein i... 57 6e-06 ref|XP_010107905.1| CBS domain-containing protein CBSX1 [Morus n... 56 8e-06 gb|KDO59776.1| hypothetical protein CISIN_1g026712mg [Citrus sin... 56 8e-06 ref|XP_006487034.1| PREDICTED: CBS domain-containing protein CBS... 56 8e-06 ref|XP_006422974.1| hypothetical protein CICLE_v10029198mg [Citr... 56 8e-06 ref|XP_006855151.1| PREDICTED: CBS domain-containing protein CBS... 56 8e-06 ref|XP_007042479.1| Cystathionine beta-synthase family protein [... 56 8e-06 >ref|XP_009377754.1| PREDICTED: CBS domain-containing protein CBSX2, chloroplastic-like [Pyrus x bretschneideri] gi|694315947|ref|XP_009377789.1| PREDICTED: CBS domain-containing protein CBSX2, chloroplastic-like [Pyrus x bretschneideri] Length = 230 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKME 330 PVIDDDWKLVGVVSDYDLLALDSISG M+ Sbjct: 104 PVIDDDWKLVGVVSDYDLLALDSISGNMK 132 >gb|KDO59777.1| hypothetical protein CISIN_1g026712mg [Citrus sinensis] Length = 188 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKM 333 PVIDDDWKLVGVVSDYDLLALDSISG M Sbjct: 110 PVIDDDWKLVGVVSDYDLLALDSISGSM 137 >ref|XP_009108754.1| PREDICTED: CBS domain-containing protein CBSX2, chloroplastic-like [Brassica rapa] Length = 233 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEH 327 PVIDDDWKLVGVVSDYDLLALDSISG+ ++ Sbjct: 109 PVIDDDWKLVGVVSDYDLLALDSISGRSQN 138 >emb|CDY51959.1| BnaA08g11590D [Brassica napus] Length = 234 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEH 327 PVIDDDWKLVGVVSDYDLLALDSISG+ ++ Sbjct: 109 PVIDDDWKLVGVVSDYDLLALDSISGRSQN 138 >emb|CDY62720.1| BnaC03g77200D [Brassica napus] Length = 229 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEH 327 PVIDDDWKLVGVVSDYDLLALDSISG+ ++ Sbjct: 105 PVIDDDWKLVGVVSDYDLLALDSISGRSQN 134 >ref|XP_012469567.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic isoform X2 [Gossypium raimondii] gi|763750362|gb|KJB17750.1| hypothetical protein B456_003G026000 [Gossypium raimondii] Length = 244 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEHSILEP 312 PVIDDDWKLVG+VSDYDLLALDSISG+ + L P Sbjct: 116 PVIDDDWKLVGLVSDYDLLALDSISGRRTENDLFP 150 >ref|XP_012469566.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic isoform X1 [Gossypium raimondii] gi|763750358|gb|KJB17746.1| hypothetical protein B456_003G026000 [Gossypium raimondii] Length = 247 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEHSILEP 312 PVIDDDWKLVG+VSDYDLLALDSISG+ + L P Sbjct: 116 PVIDDDWKLVGLVSDYDLLALDSISGRRTENDLFP 150 >ref|XP_012469568.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic isoform X3 [Gossypium raimondii] gi|763750356|gb|KJB17744.1| hypothetical protein B456_003G026000 [Gossypium raimondii] gi|763750359|gb|KJB17747.1| hypothetical protein B456_003G026000 [Gossypium raimondii] gi|763750360|gb|KJB17748.1| hypothetical protein B456_003G026000 [Gossypium raimondii] gi|763750361|gb|KJB17749.1| hypothetical protein B456_003G026000 [Gossypium raimondii] Length = 239 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEHSILEP 312 PVIDDDWKLVG+VSDYDLLALDSISG+ + L P Sbjct: 116 PVIDDDWKLVGLVSDYDLLALDSISGRRTENDLFP 150 >emb|CDO97202.1| unnamed protein product [Coffea canephora] Length = 247 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKME 330 PV+DDDWKLVGVVSDYDLLALDSISG+ + Sbjct: 123 PVVDDDWKLVGVVSDYDLLALDSISGRSQ 151 >ref|XP_008348530.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Malus domestica] Length = 83 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKME 330 PVIDDDWKLVGVVSDYDLLALDSISG ++ Sbjct: 32 PVIDDDWKLVGVVSDYDLLALDSISGNIK 60 >ref|XP_008236486.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Prunus mume] Length = 234 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKME 330 PVIDDDWKLVGVVSDYDLLALDSISG ++ Sbjct: 109 PVIDDDWKLVGVVSDYDLLALDSISGNIK 137 >ref|XP_007201268.1| hypothetical protein PRUPE_ppa010834mg [Prunus persica] gi|462396668|gb|EMJ02467.1| hypothetical protein PRUPE_ppa010834mg [Prunus persica] Length = 234 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKME 330 PVIDDDWKLVGVVSDYDLLALDSISG ++ Sbjct: 109 PVIDDDWKLVGVVSDYDLLALDSISGNIK 137 >ref|XP_007047343.1| Cystathionine beta-synthase family protein isoform 2 [Theobroma cacao] gi|508699604|gb|EOX91500.1| Cystathionine beta-synthase family protein isoform 2 [Theobroma cacao] Length = 198 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEHSILEP 312 PVIDDDWKLVG+VSDYDLLALDSISG+ + + P Sbjct: 118 PVIDDDWKLVGLVSDYDLLALDSISGRRTENDMFP 152 >ref|XP_007047342.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] gi|508699603|gb|EOX91499.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] Length = 241 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISGKMEHSILEP 312 PVIDDDWKLVG+VSDYDLLALDSISG+ + + P Sbjct: 118 PVIDDDWKLVGLVSDYDLLALDSISGRRTENDMFP 152 >ref|XP_010107905.1| CBS domain-containing protein CBSX1 [Morus notabilis] gi|587930176|gb|EXC17305.1| CBS domain-containing protein CBSX1 [Morus notabilis] Length = 234 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISG 339 PVIDDDWKLVGVVSDYDLLALDSISG Sbjct: 112 PVIDDDWKLVGVVSDYDLLALDSISG 137 >gb|KDO59776.1| hypothetical protein CISIN_1g026712mg [Citrus sinensis] Length = 234 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISG 339 PVIDDDWKLVGVVSDYDLLALDSISG Sbjct: 110 PVIDDDWKLVGVVSDYDLLALDSISG 135 >ref|XP_006487034.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Citrus sinensis] Length = 234 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISG 339 PVIDDDWKLVGVVSDYDLLALDSISG Sbjct: 110 PVIDDDWKLVGVVSDYDLLALDSISG 135 >ref|XP_006422974.1| hypothetical protein CICLE_v10029198mg [Citrus clementina] gi|557524908|gb|ESR36214.1| hypothetical protein CICLE_v10029198mg [Citrus clementina] Length = 234 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISG 339 PVIDDDWKLVGVVSDYDLLALDSISG Sbjct: 110 PVIDDDWKLVGVVSDYDLLALDSISG 135 >ref|XP_006855151.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Amborella trichopoda] gi|548858904|gb|ERN16618.1| hypothetical protein AMTR_s00051p00045410 [Amborella trichopoda] Length = 243 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISG 339 PVIDDDWKLVGVVSDYDLLALDSISG Sbjct: 117 PVIDDDWKLVGVVSDYDLLALDSISG 142 >ref|XP_007042479.1| Cystathionine beta-synthase family protein [Theobroma cacao] gi|508706414|gb|EOX98310.1| Cystathionine beta-synthase family protein [Theobroma cacao] Length = 230 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 416 PVIDDDWKLVGVVSDYDLLALDSISG 339 PVIDDDWKLVGVVSDYDLLALDSISG Sbjct: 106 PVIDDDWKLVGVVSDYDLLALDSISG 131