BLASTX nr result
ID: Cinnamomum23_contig00037814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00037814 (407 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO83798.1| hypothetical protein CISIN_1g043957mg [Citrus sin... 57 4e-06 ref|XP_006473874.1| PREDICTED: probable serine/threonine-protein... 57 4e-06 ref|XP_006434511.1| hypothetical protein CICLE_v10003527mg [Citr... 57 4e-06 >gb|KDO83798.1| hypothetical protein CISIN_1g043957mg [Citrus sinensis] Length = 584 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = -1 Query: 404 PVAFALVKSSSARAECHPWAAKNITNLPPLLPTAKIRVDSNKEDDNNIYRFSLVGRSAST 225 PVA + + S R + HP KNI N PPL P +K R ++ ED N+YR + V RSAST Sbjct: 509 PVAASHHQKMSPRNKGHPNGTKNIKNRPPL-PNSKTRPTTHNEDSGNMYRLNRVSRSAST 567 Query: 224 IDFRKL 207 +FRKL Sbjct: 568 REFRKL 573 >ref|XP_006473874.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like [Citrus sinensis] Length = 588 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = -1 Query: 404 PVAFALVKSSSARAECHPWAAKNITNLPPLLPTAKIRVDSNKEDDNNIYRFSLVGRSAST 225 PVA + + S R + HP KNI N PPL P +K R ++ ED N+YR + V RSAST Sbjct: 513 PVAASHHQKMSPRNKGHPNGTKNIKNQPPL-PNSKTRPTTHNEDSGNMYRLNRVSRSAST 571 Query: 224 IDFRKL 207 +FRKL Sbjct: 572 REFRKL 577 >ref|XP_006434511.1| hypothetical protein CICLE_v10003527mg [Citrus clementina] gi|557536633|gb|ESR47751.1| hypothetical protein CICLE_v10003527mg [Citrus clementina] Length = 584 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = -1 Query: 404 PVAFALVKSSSARAECHPWAAKNITNLPPLLPTAKIRVDSNKEDDNNIYRFSLVGRSAST 225 PVA + + S R + HP KNI N PPL P +K R ++ ED N+YR + V RSAST Sbjct: 509 PVAASHHQKMSPRNKGHPNGTKNIKNRPPL-PNSKTRPTTHNEDSGNMYRLNRVSRSAST 567 Query: 224 IDFRKL 207 +FRKL Sbjct: 568 REFRKL 573