BLASTX nr result
ID: Cinnamomum23_contig00037434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00037434 (390 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP22033.1| unnamed protein product [Coffea canephora] 48 2e-08 emb|CDP18466.1| unnamed protein product [Coffea canephora] 47 5e-08 emb|CDP04851.1| unnamed protein product [Coffea canephora] 44 1e-07 >emb|CDP22033.1| unnamed protein product [Coffea canephora] Length = 130 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -3 Query: 388 LRTYLNLPSEIVPATLKKSAKPL 320 LRTYLNLPSEI+PATLKKSAKPL Sbjct: 31 LRTYLNLPSEIIPATLKKSAKPL 53 Score = 37.0 bits (84), Expect(2) = 2e-08 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -1 Query: 231 GTGVGQEDHLVNLVVIRVELQPTTSLLSGVLVEG 130 G G D LV+LVV +VEL TSLLSGVLVEG Sbjct: 83 GYRAGPMDLLVSLVVRKVELLWITSLLSGVLVEG 116 >emb|CDP18466.1| unnamed protein product [Coffea canephora] Length = 205 Score = 46.6 bits (109), Expect(2) = 5e-08 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -3 Query: 388 LRTYLNLPSEIVPATLKKSAKPL 320 LRTYLNLPSEIVP TLKKSAKPL Sbjct: 76 LRTYLNLPSEIVPTTLKKSAKPL 98 Score = 37.0 bits (84), Expect(2) = 5e-08 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -1 Query: 219 GQEDHLVNLVVIRVELQPTTSLLSGVLVEG 130 G D LV+LVV +VEL TSLLSGVLVEG Sbjct: 132 GPVDLLVSLVVRKVELLRITSLLSGVLVEG 161 >emb|CDP04851.1| unnamed protein product [Coffea canephora] Length = 130 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -3 Query: 388 LRTYLNLPSEIVPATLKKSAKPL 320 LRTYLNLPSEI+ ATLKKSAKPL Sbjct: 31 LRTYLNLPSEIILATLKKSAKPL 53 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -1 Query: 231 GTGVGQEDHLVNLVVIRVELQPTTSLLSGVLVEG 130 G G D LV+LVV +VEL TTS+LSGVLVEG Sbjct: 83 GYRAGLVDLLVSLVVRKVELLWTTSMLSGVLVEG 116