BLASTX nr result
ID: Cinnamomum23_contig00037337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00037337 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278295.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 gb|KHN30095.1| Pentatricopeptide repeat-containing protein [Glyc... 75 2e-11 ref|XP_003543566.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_012571369.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_007046897.1| Tetratricopeptide repeat (TPR)-like superfam... 70 7e-10 gb|AEP33771.1| organelle transcript processing 82, partial [Thla... 70 7e-10 ref|XP_012079670.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 gb|KDP31652.1| hypothetical protein JCGZ_14968 [Jatropha curcas] 69 1e-09 ref|XP_003601089.1| Pentatricopeptide repeat-containing protein ... 69 1e-09 ref|XP_010263631.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_002266487.1| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 ref|XP_010923733.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_010259704.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_008776247.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_003523513.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 gb|AEP33762.1| organelle transcript processing 82, partial [Hesp... 67 6e-09 ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citr... 66 8e-09 ref|XP_011621023.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_011627730.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_009784892.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 >ref|XP_010278295.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Nelumbo nucifera] Length = 698 Score = 84.7 bits (208), Expect = 2e-14 Identities = 48/99 (48%), Positives = 59/99 (59%), Gaps = 4/99 (4%) Frame = -1 Query: 290 LHVSDVRTPAPPSRH----LPFEKSQPSIPFLPKTLPRARSIDQAKQLQAYILKSGFEPN 123 LH V PP L E+ P+ F + ++ +AKQL +YI+K G N Sbjct: 35 LHTRSVVNNLPPFASGRPPLVVEEPHPATSFFVEGRSNRYTVQEAKQLHSYIVKLG-SSN 93 Query: 122 ISFFNSLIHCYASNGSLFDAQRLFDEIPHRDVVSWTTLV 6 I F NSLIH YA NG+L DA++LFDE PHRDVVSWTTLV Sbjct: 94 IYFINSLIHVYAINGALGDARKLFDETPHRDVVSWTTLV 132 >gb|KHN30095.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 715 Score = 74.7 bits (182), Expect = 2e-11 Identities = 41/99 (41%), Positives = 53/99 (53%), Gaps = 6/99 (6%) Frame = -1 Query: 281 SDVRTPAPPSRHLPFEKSQPS------IPFLPKTLPRARSIDQAKQLQAYILKSGFEPNI 120 S P PP L S PS PFL K R++ KQL A + K GF P++ Sbjct: 71 SQTPLPTPPFHALSLFLSMPSPPDNFTFPFLLKCCSRSKLPPLGKQLHALLTKLGFAPDL 130 Query: 119 SFFNSLIHCYASNGSLFDAQRLFDEIPHRDVVSWTTLVG 3 N L+H Y+ G L A+ LFD +PHRDVVSWT+++G Sbjct: 131 YIQNVLLHMYSEFGDLLLARSLFDRMPHRDVVSWTSMIG 169 >ref|XP_003543566.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 572 Score = 74.7 bits (182), Expect = 2e-11 Identities = 41/99 (41%), Positives = 53/99 (53%), Gaps = 6/99 (6%) Frame = -1 Query: 281 SDVRTPAPPSRHLPFEKSQPS------IPFLPKTLPRARSIDQAKQLQAYILKSGFEPNI 120 S P PP L S PS PFL K R++ KQL A + K GF P++ Sbjct: 71 SQTPLPTPPFHALSLFLSMPSPPDNFTFPFLLKCCSRSKLPPLGKQLHALLTKLGFAPDL 130 Query: 119 SFFNSLIHCYASNGSLFDAQRLFDEIPHRDVVSWTTLVG 3 N L+H Y+ G L A+ LFD +PHRDVVSWT+++G Sbjct: 131 YIQNVLLHMYSEFGDLLLARSLFDRMPHRDVVSWTSMIG 169 >ref|XP_012571369.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Cicer arietinum] gi|828311930|ref|XP_012571370.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Cicer arietinum] gi|828311933|ref|XP_012571371.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Cicer arietinum] gi|828311935|ref|XP_012571372.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Cicer arietinum] Length = 689 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/71 (46%), Positives = 48/71 (67%) Frame = -1 Query: 218 IPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEIP 39 I F + R ++I QAK L +YI+KSG N+ N++I YA S +DA+ LFDE+P Sbjct: 6 IQFALRCCVRFQAIKQAKSLHSYIIKSGHFNNLFILNNMISVYAKCSSFYDARNLFDEMP 65 Query: 38 HRDVVSWTTLV 6 HR+++SWTT+V Sbjct: 66 HRNIISWTTMV 76 >ref|XP_007046897.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508699158|gb|EOX91054.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 529 Score = 69.7 bits (169), Expect = 7e-10 Identities = 30/73 (41%), Positives = 49/73 (67%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K +I++ KQ+ A+++K GF + NSL+H YA++GS+ A+ LFD + Sbjct: 120 TFPFLLKACSSLLAIEETKQIHAHVIKLGFGSEVFATNSLLHVYATSGSIKAARLLFDLV 179 Query: 41 PHRDVVSWTTLVG 3 P RD+VSW +++G Sbjct: 180 PERDIVSWNSMIG 192 >gb|AEP33771.1| organelle transcript processing 82, partial [Thlaspi arvense] Length = 673 Score = 69.7 bits (169), Expect = 7e-10 Identities = 30/72 (41%), Positives = 49/72 (68%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K+ ++++ ++ +Q+ ++LK G+EP++ SLI YA NG L DA ++FD Sbjct: 68 TFPFLLKSCAKSKAFEEGQQIHGHVLKLGYEPDLYVHTSLISMYAQNGRLEDAHKVFDRS 127 Query: 41 PHRDVVSWTTLV 6 HRDVVS+T L+ Sbjct: 128 SHRDVVSYTALI 139 >ref|XP_012079670.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Jatropha curcas] Length = 615 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/72 (44%), Positives = 48/72 (66%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K R ++++ +Q+ AYI+K GF +I NSL+H YA++GS+ AQ LFD I Sbjct: 113 TFPFLLKACSRLSALEEIQQIHAYIIKLGFGSDIYSTNSLLHAYAASGSIKSAQVLFDRI 172 Query: 41 PHRDVVSWTTLV 6 DVVSW +++ Sbjct: 173 SQPDVVSWNSMI 184 >gb|KDP31652.1| hypothetical protein JCGZ_14968 [Jatropha curcas] Length = 592 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/72 (44%), Positives = 48/72 (66%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K R ++++ +Q+ AYI+K GF +I NSL+H YA++GS+ AQ LFD I Sbjct: 90 TFPFLLKACSRLSALEEIQQIHAYIIKLGFGSDIYSTNSLLHAYAASGSIKSAQVLFDRI 149 Query: 41 PHRDVVSWTTLV 6 DVVSW +++ Sbjct: 150 SQPDVVSWNSMI 161 >ref|XP_003601089.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355490137|gb|AES71340.1| PPR containing plant-like protein [Medicago truncatula] Length = 745 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/62 (50%), Positives = 45/62 (72%) Frame = -1 Query: 191 RARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEIPHRDVVSWTT 12 R RSI AK L ++I+KSGF +I N++I Y+ S+ DA+ +FDE+PHR++VSWTT Sbjct: 15 RFRSIKNAKSLHSHIIKSGFCNHIFILNNMISVYSKCSSIIDARNMFDEMPHRNIVSWTT 74 Query: 11 LV 6 +V Sbjct: 75 MV 76 >ref|XP_010263631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Nelumbo nucifera] Length = 626 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/72 (41%), Positives = 46/72 (63%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K ++++ +Q+ +LK+GF +I NSLIH YA +GSL A RLFD + Sbjct: 126 TFPFLLKACATLSALEETRQIHGQVLKTGFAIDIYAANSLIHAYAKSGSLTSAHRLFDRV 185 Query: 41 PHRDVVSWTTLV 6 RD+VSW +++ Sbjct: 186 QERDIVSWNSMI 197 >ref|XP_002266487.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Vitis vinifera] Length = 553 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -1 Query: 215 PFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEIPH 36 P + K R S+ + K++ A++ K+G + ++ N+L+H Y S G + DA+RLFD +PH Sbjct: 78 PAMLKACWRMGSLSKGKEVHAHVTKTGLDSDVYVGNALLHLYGSTGQVTDARRLFDGMPH 137 Query: 35 RDVVSWTTLVG 3 RD+ SW TL+G Sbjct: 138 RDLASWNTLLG 148 >ref|XP_010923733.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Elaeis guineensis] Length = 623 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/73 (41%), Positives = 51/73 (69%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 ++PF+ K+ +A + +A + A I K GFE I N+L+H Y+S GS+ A+++FDEI Sbjct: 90 TLPFVLKSCAKASAHVEALTVHAMIFKLGFESQIFVMNALLHAYSSCGSMSLARKVFDEI 149 Query: 41 PHRDVVSWTTLVG 3 P+R++VSW +++G Sbjct: 150 PYRNIVSWNSVIG 162 >ref|XP_010259704.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 505 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/72 (41%), Positives = 44/72 (61%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K + + ++ +++K GF +I NSLIH Y SN + A R+FDE+ Sbjct: 90 TFPFLLKACSVLSDLHKGQETHCHVIKQGFLSDIFVRNSLIHLYGSNSKIKIAHRIFDEM 149 Query: 41 PHRDVVSWTTLV 6 PHRD+ +WTTLV Sbjct: 150 PHRDIATWTTLV 161 >ref|XP_008776247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Phoenix dactylifera] Length = 476 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/85 (36%), Positives = 50/85 (58%) Frame = -1 Query: 260 PPSRHLPFEKSQPSIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASN 81 PP +H + PF+ K S+ ++QLQA+ILK G + ++ N L+ CYA+ Sbjct: 125 PPGKH--------TFPFVLKACVNVHSLSTSQQLQAHILKHGLDSDLYVINGLVRCYAAC 176 Query: 80 GSLFDAQRLFDEIPHRDVVSWTTLV 6 + A+RLFDE P R+++ WTT++ Sbjct: 177 ELVHGARRLFDEAPERNLIIWTTMI 201 >ref|XP_003523513.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 542 Score = 66.6 bits (161), Expect = 6e-09 Identities = 35/88 (39%), Positives = 50/88 (56%) Frame = -1 Query: 269 TPAPPSRHLPFEKSQPSIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCY 90 +P PP+ F + PFL K ++ KQL A + K GF P++ N L+H Y Sbjct: 58 SPKPPTPPYNF-----TFPFLLKCCAPSKLPPLGKQLHALLTKLGFAPDLYIQNVLVHMY 112 Query: 89 ASNGSLFDAQRLFDEIPHRDVVSWTTLV 6 + G L A+ LFD +PHRDVVSWT+++ Sbjct: 113 SEFGDLVLARSLFDRMPHRDVVSWTSMI 140 >gb|AEP33762.1| organelle transcript processing 82, partial [Hesperis matronalis] Length = 672 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/72 (41%), Positives = 48/72 (66%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K+ ++++ + +Q+ ++LK GF+ ++ SLI YA NG L DAQ++FD Sbjct: 77 TFPFLLKSCAKSKTFKEGQQIHGHVLKLGFDLDLYVHTSLISMYAQNGRLEDAQKVFDRS 136 Query: 41 PHRDVVSWTTLV 6 HRDVVS+T L+ Sbjct: 137 SHRDVVSYTALI 148 >ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] gi|568824869|ref|XP_006466814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] gi|557527644|gb|ESR38894.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] Length = 622 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/72 (38%), Positives = 46/72 (63%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K R ++++ +Q+ A I+K GF + NSL+H YA +GS+ A+ +FD + Sbjct: 120 TFPFLLKACSRLSALEETQQIHAQIIKFGFSSEVFATNSLLHAYAISGSIKSARLIFDHM 179 Query: 41 PHRDVVSWTTLV 6 P RD VSW +++ Sbjct: 180 PQRDTVSWNSMI 191 >ref|XP_011621023.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Amborella trichopoda] Length = 489 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/72 (44%), Positives = 46/72 (63%) Frame = -1 Query: 221 SIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEI 42 + PFL K R S A QL A+I+ GFE ++ N L+H Y S G L DA+++FDEI Sbjct: 139 TFPFLLKASARIISFSTATQLHAHIIHLGFETDVYVSNGLLHVYCSCGLLTDARKVFDEI 198 Query: 41 PHRDVVSWTTLV 6 P R+V+ +TT++ Sbjct: 199 PQRNVIIFTTMI 210 >ref|XP_011627730.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Amborella trichopoda] Length = 498 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/60 (43%), Positives = 44/60 (73%) Frame = -1 Query: 185 RSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQRLFDEIPHRDVVSWTTLV 6 +S+ + K L +IL+S ++P+IS FN L+ Y+ + S+ DAQ +FDE+P R+++SW TL+ Sbjct: 147 KSLKEGKMLHEHILRSSYKPSISIFNKLMEMYSKSRSMIDAQTVFDEMPERNLISWNTLI 206 >ref|XP_009784892.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial [Nicotiana sylvestris] Length = 602 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/77 (38%), Positives = 48/77 (62%) Frame = -1 Query: 236 EKSQPSIPFLPKTLPRARSIDQAKQLQAYILKSGFEPNISFFNSLIHCYASNGSLFDAQR 57 E + + PF+ K ++ + KQ + LK GF+ ++ NSLIH Y+S GSL DA+R Sbjct: 121 EPDKHTFPFVLKACAYLFALSEGKQAHGFALKLGFDSDVYINNSLIHFYSSCGSLKDARR 180 Query: 56 LFDEIPHRDVVSWTTLV 6 +FD++P R +VSW ++ Sbjct: 181 VFDKMPERSLVSWNVMI 197