BLASTX nr result
ID: Cinnamomum23_contig00036725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00036725 (239 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 88 1e-15 ref|XP_012575409.1| PREDICTED: uncharacterized protein LOC105852... 70 2e-12 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 57 4e-06 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 88.2 bits (217), Expect(2) = 1e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 114 HRGVVARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHD 239 H GVVARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHD Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHD 794 Score = 21.2 bits (43), Expect(2) = 1e-15 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 97 CASDRHIG 120 CASDRH+G Sbjct: 748 CASDRHMG 755 >ref|XP_012575409.1| PREDICTED: uncharacterized protein LOC105852994 [Cicer arietinum] Length = 385 Score = 70.5 bits (171), Expect(2) = 2e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 125 GCPGFSAWYPAPRVHDIYIQLCPGDTVEARPPSVLLSR 238 GCPGFSAWYP PR+HDIYIQ G+TVEARPPSVLLSR Sbjct: 107 GCPGFSAWYPTPRIHDIYIQ---GNTVEARPPSVLLSR 141 Score = 27.7 bits (60), Expect(2) = 2e-12 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 97 CASDRHIGEWLPGF 138 CASDRHIG PGF Sbjct: 98 CASDRHIGVGCPGF 111 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 168 MISTFNCAPETRSKHARPVCFFHD 239 MISTFNCAPETRSKHARPVCFFHD Sbjct: 1 MISTFNCAPETRSKHARPVCFFHD 24