BLASTX nr result
ID: Cinnamomum23_contig00036656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00036656 (705 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 76 2e-11 ref|XP_010269231.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-11 ref|XP_012067167.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 gb|KDP42034.1| hypothetical protein JCGZ_03097 [Jatropha curcas] 69 2e-09 ref|XP_006847961.2| PREDICTED: pentatricopeptide repeat-containi... 69 3e-09 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 69 3e-09 gb|ERN09542.1| hypothetical protein AMTR_s00029p00147240 [Ambore... 69 3e-09 ref|XP_007041612.1| Pentatricopeptide repeat (PPR) superfamily p... 69 3e-09 ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily p... 69 3e-09 ref|XP_006296960.1| hypothetical protein CARUB_v10012952mg, part... 68 4e-09 ref|XP_008803983.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-08 ref|XP_010935458.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-08 ref|XP_010489330.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-08 ref|XP_010467466.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-08 ref|XP_009418657.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-08 ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. l... 66 2e-08 ref|XP_011040795.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-08 ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Popu... 65 4e-08 gb|KDO68326.1| hypothetical protein CISIN_1g044873mg [Citrus sin... 65 5e-08 ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containi... 65 5e-08 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|731382609|ref|XP_010645876.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 76.3 bits (186), Expect = 2e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDT 572 I+HRDDGSGLA+K LKR Q+GWGQGS+ SLQP+KNDF++ WE T Sbjct: 834 IIHRDDGSGLALKALKRVQKGWGQGSISSLQPQKNDFLDYWEGT 877 >ref|XP_010269231.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Nelumbo nucifera] gi|720042423|ref|XP_010269232.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Nelumbo nucifera] Length = 877 Score = 75.1 bits (183), Expect = 4e-11 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 +LHRDDGS +A+KVLKR Q+GWGQGS+LS+QP+K+DF++ WE TG Sbjct: 833 LLHRDDGSRIAIKVLKRVQKGWGQGSILSVQPQKSDFLDYWEGTG 877 >ref|XP_012067167.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Jatropha curcas] Length = 873 Score = 69.3 bits (168), Expect = 2e-09 Identities = 27/45 (60%), Positives = 39/45 (86%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 I+HRDDGSG+A+K LKR Q+GWGQGS+ +LQP+K++F + W+ +G Sbjct: 829 IVHRDDGSGIALKALKRVQKGWGQGSISTLQPQKDEFFDYWDGSG 873 >gb|KDP42034.1| hypothetical protein JCGZ_03097 [Jatropha curcas] Length = 736 Score = 69.3 bits (168), Expect = 2e-09 Identities = 27/45 (60%), Positives = 39/45 (86%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 I+HRDDGSG+A+K LKR Q+GWGQGS+ +LQP+K++F + W+ +G Sbjct: 692 IVHRDDGSGIALKALKRVQKGWGQGSISTLQPQKDEFFDYWDGSG 736 >ref|XP_006847961.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Amborella trichopoda] Length = 827 Score = 68.9 bits (167), Expect = 3e-09 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWED 575 +LHRDDGSG+AMKVLKR Q+GWGQG++ + P K+D +EDWE+ Sbjct: 783 LLHRDDGSGIAMKVLKRIQKGWGQGAIPTSPPPKHDILEDWEE 825 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 68.9 bits (167), Expect = 3e-09 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 I+HRDDGSG+A+K LKR Q+GWGQGS+ SLQP+K +F + W+ +G Sbjct: 830 IVHRDDGSGIALKALKRVQKGWGQGSISSLQPQKLEFFDYWDGSG 874 >gb|ERN09542.1| hypothetical protein AMTR_s00029p00147240 [Amborella trichopoda] Length = 889 Score = 68.9 bits (167), Expect = 3e-09 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWED 575 +LHRDDGSG+AMKVLKR Q+GWGQG++ + P K+D +EDWE+ Sbjct: 845 LLHRDDGSGIAMKVLKRIQKGWGQGAIPTSPPPKHDILEDWEE 887 >ref|XP_007041612.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] gi|508705547|gb|EOX97443.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 632 Score = 68.6 bits (166), Expect = 3e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 I+HRDDGSG+A+K LKR Q+GWGQGS+ LQP KN F + WE G Sbjct: 588 IVHRDDGSGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWEGDG 632 >ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508705546|gb|EOX97442.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 872 Score = 68.6 bits (166), Expect = 3e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 I+HRDDGSG+A+K LKR Q+GWGQGS+ LQP KN F + WE G Sbjct: 828 IVHRDDGSGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWEGDG 872 >ref|XP_006296960.1| hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] gi|482565669|gb|EOA29858.1| hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] Length = 881 Score = 68.2 bits (165), Expect = 4e-09 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 ILHRDDGSG+A+K L R ++GWGQG + S QP+++D+++ WED G Sbjct: 837 ILHRDDGSGIALKTLSRVKKGWGQGDISSFQPQRDDYLDYWEDDG 881 >ref|XP_008803983.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Phoenix dactylifera] gi|672112085|ref|XP_008803992.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Phoenix dactylifera] Length = 881 Score = 66.2 bits (160), Expect = 2e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 +LHRDDGSG+AMKVLKR Q+GWGQGS+ S +P+ D + WE TG Sbjct: 837 LLHRDDGSGIAMKVLKRVQKGWGQGSIPSPRPQNVDPFDVWESTG 881 >ref|XP_010935458.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Elaeis guineensis] gi|743834166|ref|XP_010935459.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Elaeis guineensis] Length = 881 Score = 65.9 bits (159), Expect = 2e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 +LHRDDGSG+AMKVLKR Q+GWGQGS+ S +P+ D + WE TG Sbjct: 837 LLHRDDGSGVAMKVLKRVQKGWGQGSIPSPRPQNVDPFDVWESTG 881 >ref|XP_010489330.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Camelina sativa] gi|727636432|ref|XP_010489331.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Camelina sativa] gi|727636434|ref|XP_010489332.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Camelina sativa] Length = 879 Score = 65.9 bits (159), Expect = 2e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 ILHRDDGSG+A+K L R ++GWGQG + S QP++ D+++ WED G Sbjct: 835 ILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWEDDG 879 >ref|XP_010467466.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Camelina sativa] Length = 878 Score = 65.9 bits (159), Expect = 2e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 ILHRDDGSG+A+K L R ++GWGQG + S QP++ D+++ WED G Sbjct: 834 ILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWEDDG 878 >ref|XP_009418657.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Musa acuminata subsp. malaccensis] Length = 883 Score = 65.9 bits (159), Expect = 2e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDT 572 +LHRDDGSG+AMK+LKR Q+GWGQGS+ + +P+ D V++WE T Sbjct: 839 LLHRDDGSGIAMKLLKRVQKGWGQGSIPAPRPQNFDLVDEWEIT 882 >ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329881|gb|EFH60300.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 65.9 bits (159), Expect = 2e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWEDTG 569 ILHRDDGSG+A+K L R ++GWGQG + S QP++ D+++ WED G Sbjct: 830 ILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWEDDG 874 >ref|XP_011040795.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Populus euphratica] Length = 874 Score = 65.1 bits (157), Expect = 4e-08 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWE 578 ILHRDDGSG+A+K LKR QRG QGS+ SL+P+K+DF++ WE Sbjct: 830 ILHRDDGSGIALKALKRVQRGLDQGSISSLEPQKDDFLDYWE 871 >ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] gi|550341611|gb|ERP62640.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] Length = 874 Score = 65.1 bits (157), Expect = 4e-08 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWE 578 ILHRDDGSG+A+K LKR QRG QGS+ SL+P+K+DF++ WE Sbjct: 830 ILHRDDGSGIALKALKRVQRGLDQGSISSLEPQKDDFLDYWE 871 >gb|KDO68326.1| hypothetical protein CISIN_1g044873mg [Citrus sinensis] Length = 874 Score = 64.7 bits (156), Expect = 5e-08 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWE 578 ILHR+DGSG+A+K LKR Q+GWGQGS+ SLQ +K D ++ WE Sbjct: 818 ILHREDGSGIALKTLKRVQKGWGQGSISSLQAQKYDLLDYWE 859 >ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] gi|568866524|ref|XP_006486605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] Length = 889 Score = 64.7 bits (156), Expect = 5e-08 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 703 ILHRDDGSGLAMKVLKRTQRGWGQGSVLSLQPRKNDFVEDWE 578 ILHR+DGSG+A+K LKR Q+GWGQGS+ SLQ +K D ++ WE Sbjct: 833 ILHREDGSGIALKTLKRVQKGWGQGSISSLQAQKYDLLDYWE 874