BLASTX nr result
ID: Cinnamomum23_contig00036191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00036191 (552 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010276672.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_010276672.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Nelumbo nucifera] Length = 586 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = -3 Query: 163 DPWIVKIISTLYVHSRSLSTTLVDFLSIELNPCIAYHCIRRLKNPKLALGFFEF 2 + W+VK+I TL V S SL T L D+ S LNP IAY I+RL+NP L+L FEF Sbjct: 83 EAWVVKVICTLCVRSSSLDTCL-DYFSKNLNPSIAYEVIKRLRNPNLSLKLFEF 135