BLASTX nr result
ID: Cinnamomum23_contig00036118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00036118 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010943863.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_008223521.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_010251726.1| PREDICTED: pentatricopeptide repeat-containi... 116 5e-24 emb|CDP14216.1| unnamed protein product [Coffea canephora] 116 5e-24 ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily pr... 115 9e-24 ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prun... 115 1e-23 ref|XP_008390483.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_008790494.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 emb|CBI24015.3| unnamed protein product [Vitis vinifera] 113 4e-23 ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containi... 113 4e-23 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 113 4e-23 ref|XP_012487551.1| PREDICTED: pentatricopeptide repeat-containi... 113 6e-23 ref|XP_011621858.1| PREDICTED: pentatricopeptide repeat-containi... 112 8e-23 ref|XP_009369706.1| PREDICTED: pentatricopeptide repeat-containi... 112 8e-23 ref|XP_011659892.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 gb|KGN66073.1| hypothetical protein Csa_1G569490 [Cucumis sativus] 112 1e-22 ref|XP_008450642.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_009359788.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_008360231.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_009795612.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 110 4e-22 >ref|XP_010943863.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Elaeis guineensis] Length = 630 Score = 118 bits (295), Expect = 2e-24 Identities = 53/67 (79%), Positives = 64/67 (95%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL EA+K+IDEMPM PDAGVLGALLGACKIHG++++GE+IG+ VIEL+PQ Sbjct: 400 CMVDLLGRAGLLEEAKKIIDEMPMEPDAGVLGALLGACKIHGNVELGEQIGRRVIELDPQ 459 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 460 NSGRYVL 466 >ref|XP_008223521.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 624 Score = 117 bits (292), Expect = 4e-24 Identities = 53/67 (79%), Positives = 62/67 (92%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAG+L EARKLI EMPMSPD G+LGALLGACKIHG++++GE IGK VIELEP+ Sbjct: 394 CMVDLLGRAGMLEEARKLISEMPMSPDVGILGALLGACKIHGNVELGEHIGKRVIELEPE 453 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 454 NSGRYVL 460 >ref|XP_010251726.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 624 Score = 116 bits (291), Expect = 5e-24 Identities = 55/67 (82%), Positives = 62/67 (92%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 C+VDLLGRAGLL EAR LIDEMPMSPDAGVLGALLGAC+IH +I++GEKIGK VIELEP Sbjct: 394 CIVDLLGRAGLLEEARNLIDEMPMSPDAGVLGALLGACRIHREIELGEKIGKQVIELEPH 453 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 454 NSGRYVL 460 >emb|CDP14216.1| unnamed protein product [Coffea canephora] Length = 597 Score = 116 bits (291), Expect = 5e-24 Identities = 55/67 (82%), Positives = 61/67 (91%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL EARK+IDEMPM PD GVLGALLGACKIHG+I +GE+IGK VIELEP Sbjct: 367 CMVDLLGRAGLLEEARKVIDEMPMRPDVGVLGALLGACKIHGNIKLGEEIGKQVIELEPS 426 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 427 NSGRYVL 433 >ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508715014|gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 628 Score = 115 bits (289), Expect = 9e-24 Identities = 52/67 (77%), Positives = 64/67 (95%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL++A+KLID+MPMSPD GVLGAL GAC+IHG+I++GE+IGK VIELEP+ Sbjct: 398 CMVDLLGRAGLLDDAKKLIDQMPMSPDVGVLGALFGACRIHGNIELGEQIGKRVIELEPE 457 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 458 NSGRYVL 464 >ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] gi|462423715|gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] Length = 624 Score = 115 bits (288), Expect = 1e-23 Identities = 53/67 (79%), Positives = 62/67 (92%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAG+L EARKLI EMPMSPD GVLGALLGACKIHG++++GE IG+ VIELEP+ Sbjct: 394 CMVDLLGRAGMLEEARKLISEMPMSPDVGVLGALLGACKIHGNVELGEHIGRIVIELEPE 453 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 454 NSGRYVL 460 >ref|XP_008390483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Malus domestica] Length = 627 Score = 114 bits (286), Expect = 2e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAG L EARKLI+EMPMSPD GVLGALLGACKIHG++++G++IG+ VIELEP+ Sbjct: 397 CMVDLLGRAGRLEEARKLINEMPMSPDVGVLGALLGACKIHGNVELGDEIGRRVIELEPE 456 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 457 NSGRYVL 463 >ref|XP_008790494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Phoenix dactylifera] Length = 632 Score = 114 bits (285), Expect = 3e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL EA+K+IDEMPM DAGVLGALLGACKIHG++++GE+IG+ VIEL+PQ Sbjct: 402 CMVDLLGRAGLLEEAKKIIDEMPMEADAGVLGALLGACKIHGNVELGEQIGRLVIELDPQ 461 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 462 NSGRYVL 468 >emb|CBI24015.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 113 bits (283), Expect = 4e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL EARKLI+EMP++PDAGVLGAL+GAC+IHG+ ++GE+IGK VIELEP Sbjct: 339 CMVDLLGRAGLLEEARKLINEMPVNPDAGVLGALVGACRIHGNTELGEQIGKKVIELEPH 398 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 399 NSGRYVL 405 >ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 624 Score = 113 bits (283), Expect = 4e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL EARKLI+EMP++PDAGVLGAL+GAC+IHG+ ++GE+IGK VIELEP Sbjct: 394 CMVDLLGRAGLLEEARKLINEMPVNPDAGVLGALVGACRIHGNTELGEQIGKKVIELEPH 453 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 454 NSGRYVL 460 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 113 bits (283), Expect = 4e-23 Identities = 53/67 (79%), Positives = 63/67 (94%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 C+VDLLGRAGLL EAR++I+EMPMSPD GVLGALLGAC+IH +I++GEKIGK VIELEPQ Sbjct: 398 CLVDLLGRAGLLVEARRVINEMPMSPDVGVLGALLGACRIHKNIELGEKIGKQVIELEPQ 457 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 458 NSGRYVL 464 >ref|XP_012487551.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium raimondii] gi|763771463|gb|KJB38678.1| hypothetical protein B456_006G266600 [Gossypium raimondii] Length = 630 Score = 113 bits (282), Expect = 6e-23 Identities = 50/67 (74%), Positives = 62/67 (92%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL+EA+KLID+MPM+PD GVLGAL GAC+IHG+ ++GE++GK VIELEP Sbjct: 398 CMVDLLGRAGLLDEAKKLIDQMPMTPDVGVLGALFGACRIHGNFELGEQVGKRVIELEPN 457 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 458 NSGRYVL 464 >ref|XP_011621858.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 638 Score = 112 bits (281), Expect = 8e-23 Identities = 53/67 (79%), Positives = 61/67 (91%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAGLL EA+KLIDEMPM PDA VLGAL GACKIHG+I++GE++GK VIELEP Sbjct: 408 CMVDLLGRAGLLVEAKKLIDEMPMKPDAVVLGALFGACKIHGNIEIGEQVGKQVIELEPH 467 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 468 NSGRYVL 474 >ref|XP_009369706.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] Length = 627 Score = 112 bits (281), Expect = 8e-23 Identities = 51/67 (76%), Positives = 63/67 (94%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAG L EARKLI+EMPMSP+ GVLGALLGACKIHG++++G++IG+ VIELEP+ Sbjct: 397 CMVDLLGRAGRLEEARKLINEMPMSPNVGVLGALLGACKIHGNVELGDEIGRRVIELEPE 456 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 457 NSGRYVL 463 >ref|XP_011659892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 619 Score = 112 bits (279), Expect = 1e-22 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDL GRAGLL EA K+IDEMPMSPD GVLGA +GACKIHG+I++GE++GK VIELEP Sbjct: 395 CMVDLYGRAGLLEEAMKVIDEMPMSPDVGVLGAFVGACKIHGNIELGEEVGKRVIELEPT 454 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 455 NSGRYVL 461 >gb|KGN66073.1| hypothetical protein Csa_1G569490 [Cucumis sativus] Length = 611 Score = 112 bits (279), Expect = 1e-22 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDL GRAGLL EA K+IDEMPMSPD GVLGA +GACKIHG+I++GE++GK VIELEP Sbjct: 395 CMVDLYGRAGLLEEAMKVIDEMPMSPDVGVLGAFVGACKIHGNIELGEEVGKRVIELEPT 454 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 455 NSGRYVL 461 >ref|XP_008450642.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis melo] Length = 444 Score = 112 bits (279), Expect = 1e-22 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDL GRAGLL EA K+IDEMPMSPD GVLGA +GACKIHG+I++GE++GK VIELEP Sbjct: 220 CMVDLYGRAGLLEEAMKVIDEMPMSPDVGVLGAFVGACKIHGNIELGEEVGKRVIELEPT 279 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 280 NSGRYVL 286 >ref|XP_009359788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] Length = 627 Score = 111 bits (278), Expect = 2e-22 Identities = 51/67 (76%), Positives = 62/67 (92%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAG L EARKLI+EMPMSP+ GVLGALLGACKIHG+ ++G++IG+ VIELEP+ Sbjct: 397 CMVDLLGRAGRLEEARKLINEMPMSPNVGVLGALLGACKIHGNFELGDEIGRRVIELEPE 456 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 457 NSGRYVL 463 >ref|XP_008360231.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Malus domestica] Length = 625 Score = 111 bits (277), Expect = 2e-22 Identities = 51/67 (76%), Positives = 62/67 (92%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 CMVDLLGRAG L EARKLI+EMPMSPD GVLGALLGACKIHG++++GE+IG+ VI+LE + Sbjct: 395 CMVDLLGRAGRLEEARKLINEMPMSPDVGVLGALLGACKIHGNVELGEEIGRRVIKLEAE 454 Query: 78 NSGRYIV 58 NSGRY++ Sbjct: 455 NSGRYVL 461 >ref|XP_009795612.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana sylvestris] Length = 626 Score = 110 bits (275), Expect = 4e-22 Identities = 53/67 (79%), Positives = 60/67 (89%) Frame = -3 Query: 258 CMVDLLGRAGLLNEARKLIDEMPMSPDAGVLGALLGACKIHGDIDMGEKIGKGVIELEPQ 79 C+VDLLGRAGLL EARK+I EMPMS D GVLGALLGAC+IH +I++GE IGK VIELEPQ Sbjct: 396 CLVDLLGRAGLLEEARKIIKEMPMSADVGVLGALLGACRIHKNIELGEIIGKQVIELEPQ 455 Query: 78 NSGRYIV 58 NSGRY+V Sbjct: 456 NSGRYVV 462