BLASTX nr result
ID: Cinnamomum23_contig00035749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00035749 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846131.1| PREDICTED: osmotin-like protein [Amborella t... 77 6e-12 ref|XP_008776643.1| PREDICTED: LOW QUALITY PROTEIN: osmotin-like... 75 1e-11 ref|XP_010918389.1| PREDICTED: osmotin-like protein [Elaeis guin... 75 2e-11 ref|XP_002298366.1| osmotin-like family protein [Populus trichoc... 74 4e-11 ref|XP_012446484.1| PREDICTED: osmotin-like protein [Gossypium r... 74 5e-11 ref|XP_009388624.1| PREDICTED: osmotin-like protein [Musa acumin... 74 5e-11 ref|XP_011000269.1| PREDICTED: osmotin-like protein [Populus eup... 73 6e-11 ref|XP_010033142.1| PREDICTED: LOW QUALITY PROTEIN: osmotin-like... 73 6e-11 ref|XP_009594695.1| PREDICTED: osmotin-like protein [Nicotiana t... 73 6e-11 ref|XP_012065012.1| PREDICTED: osmotin-like protein [Jatropha cu... 73 6e-11 gb|KCW52693.1| hypothetical protein EUGRSUZ_J02061, partial [Euc... 73 6e-11 ref|XP_010259948.1| PREDICTED: osmotin-like protein [Nelumbo nuc... 73 8e-11 ref|XP_009800616.1| PREDICTED: osmotin-like protein [Nicotiana s... 73 8e-11 ref|XP_012827362.1| PREDICTED: osmotin-like protein [Erythranthe... 73 8e-11 ref|XP_006349009.1| PREDICTED: osmotin-like protein-like [Solanu... 73 8e-11 ref|XP_007016468.1| Osmotin-like protein [Theobroma cacao] gi|50... 73 8e-11 emb|CDP09032.1| unnamed protein product [Coffea canephora] 72 1e-10 dbj|BAI63297.1| thaumatin-like protein [Citrus jambhiri] 72 1e-10 ref|XP_002531364.1| Zeamatin precursor, putative [Ricinus commun... 72 1e-10 ref|XP_002313445.1| osmotin-like family protein [Populus trichoc... 72 1e-10 >ref|XP_006846131.1| PREDICTED: osmotin-like protein [Amborella trichopoda] gi|548848901|gb|ERN07806.1| hypothetical protein AMTR_s00012p00157270 [Amborella trichopoda] Length = 246 Score = 76.6 bits (187), Expect = 6e-12 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 STYS+FFKH CPAT TY +D PSL HNCV PRELKVIFCH Sbjct: 207 STYSEFFKHKCPATFTYAHDSPSLTHNCVEPRELKVIFCH 246 >ref|XP_008776643.1| PREDICTED: LOW QUALITY PROTEIN: osmotin-like protein [Phoenix dactylifera] Length = 257 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 STYS+FFKHACPAT TY +D PSL H+C SP+ELKVIFCH Sbjct: 218 STYSEFFKHACPATFTYAHDSPSLTHDCASPKELKVIFCH 257 >ref|XP_010918389.1| PREDICTED: osmotin-like protein [Elaeis guineensis] Length = 260 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 STYS+FFKHACPAT TY +D PSL H+C SP+ELKVIFCH Sbjct: 221 STYSEFFKHACPATFTYAHDSPSLTHDCESPKELKVIFCH 260 >ref|XP_002298366.1| osmotin-like family protein [Populus trichocarpa] gi|118487320|gb|ABK95488.1| unknown [Populus trichocarpa] gi|222845624|gb|EEE83171.1| osmotin-like family protein [Populus trichocarpa] Length = 249 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 ST+S+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 210 STFSEFFKHACPATFTYAHDSPSLTHECSSPRELKVIFCH 249 >ref|XP_012446484.1| PREDICTED: osmotin-like protein [Gossypium raimondii] gi|763788909|gb|KJB55905.1| hypothetical protein B456_009G100600 [Gossypium raimondii] Length = 248 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H+C SPRELKVIFCH Sbjct: 209 SSYSEFFKHACPATFTYAHDSPSLMHDCSSPRELKVIFCH 248 >ref|XP_009388624.1| PREDICTED: osmotin-like protein [Musa acuminata subsp. malaccensis] Length = 254 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C +PRELKVIFCH Sbjct: 215 SSYSEFFKHACPATFTYAHDSPSLTHECAAPRELKVIFCH 254 >ref|XP_011000269.1| PREDICTED: osmotin-like protein [Populus euphratica] Length = 249 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 ST+S+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 210 STFSEFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 249 >ref|XP_010033142.1| PREDICTED: LOW QUALITY PROTEIN: osmotin-like protein [Eucalyptus grandis] Length = 250 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 211 SSYSEFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 250 >ref|XP_009594695.1| PREDICTED: osmotin-like protein [Nicotiana tomentosiformis] Length = 252 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 213 SSYSEFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 252 >ref|XP_012065012.1| PREDICTED: osmotin-like protein [Jatropha curcas] gi|643738230|gb|KDP44218.1| hypothetical protein JCGZ_05685 [Jatropha curcas] Length = 250 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 211 SSYSEFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 250 >gb|KCW52693.1| hypothetical protein EUGRSUZ_J02061, partial [Eucalyptus grandis] Length = 224 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 185 SSYSEFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 224 >ref|XP_010259948.1| PREDICTED: osmotin-like protein [Nelumbo nucifera] Length = 264 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+Y++FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 225 SSYAEFFKHACPATVTYAHDSPSLMHQCSSPRELKVIFCH 264 >ref|XP_009800616.1| PREDICTED: osmotin-like protein [Nicotiana sylvestris] Length = 252 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C SPRELK+IFCH Sbjct: 213 SSYSEFFKHACPATFTYAHDSPSLMHECSSPRELKIIFCH 252 >ref|XP_012827362.1| PREDICTED: osmotin-like protein [Erythranthe guttatus] gi|604299387|gb|EYU19299.1| hypothetical protein MIMGU_mgv1a012525mg [Erythranthe guttata] Length = 248 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS+FFKHACPAT TY +D PSL H C +PRELKVIFCH Sbjct: 209 SSYSEFFKHACPATFTYAHDSPSLTHECSAPRELKVIFCH 248 >ref|XP_006349009.1| PREDICTED: osmotin-like protein-like [Solanum tuberosum] Length = 251 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 212 SSYSQFFKHACPATITYAHDSPSLMHECSSPRELKVIFCH 251 >ref|XP_007016468.1| Osmotin-like protein [Theobroma cacao] gi|508786831|gb|EOY34087.1| Osmotin-like protein [Theobroma cacao] Length = 253 Score = 72.8 bits (177), Expect = 8e-11 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S++S+FFKHACPAT TY +D PSL H C SPRELK+IFCH Sbjct: 214 SSFSEFFKHACPATFTYAHDSPSLTHECASPRELKIIFCH 253 >emb|CDP09032.1| unnamed protein product [Coffea canephora] Length = 250 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YSD+FKHACPAT TY +D PSL H C +PRELKVIFCH Sbjct: 211 SSYSDYFKHACPATFTYAHDSPSLMHECSAPRELKVIFCH 250 >dbj|BAI63297.1| thaumatin-like protein [Citrus jambhiri] Length = 248 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S++S+FFKHACPAT TY +D PSL H+C SPRELKVIFCH Sbjct: 209 SSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFCH 248 >ref|XP_002531364.1| Zeamatin precursor, putative [Ricinus communis] gi|223529024|gb|EEF31012.1| Zeamatin precursor, putative [Ricinus communis] Length = 254 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S+YS FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 215 SSYSQFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 254 >ref|XP_002313445.1| osmotin-like family protein [Populus trichocarpa] gi|222849853|gb|EEE87400.1| osmotin-like family protein [Populus trichocarpa] Length = 238 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 285 STYSDFFKHACPATATYGYDRPSLNHNCVSPRELKVIFCH 166 S++S+FFKHACPAT TY +D PSL H C SPRELKVIFCH Sbjct: 199 SSFSEFFKHACPATFTYAHDSPSLTHECSSPRELKVIFCH 238