BLASTX nr result
ID: Cinnamomum23_contig00035551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00035551 (288 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269295.1| PREDICTED: pentatricopeptide repeat-containi... 138 2e-30 ref|XP_010937492.1| PREDICTED: pentatricopeptide repeat-containi... 137 4e-30 ref|XP_009381501.1| PREDICTED: pentatricopeptide repeat-containi... 137 4e-30 ref|XP_010662158.1| PREDICTED: pentatricopeptide repeat-containi... 133 4e-29 ref|XP_008802225.1| PREDICTED: pentatricopeptide repeat-containi... 133 4e-29 emb|CBI26593.3| unnamed protein product [Vitis vinifera] 133 4e-29 ref|XP_009370728.1| PREDICTED: pentatricopeptide repeat-containi... 133 5e-29 ref|XP_008234126.1| PREDICTED: pentatricopeptide repeat-containi... 133 5e-29 ref|XP_007207635.1| hypothetical protein PRUPE_ppa021864mg [Prun... 132 7e-29 emb|CAN64701.1| hypothetical protein VITISV_037299 [Vitis vinifera] 132 9e-29 ref|XP_008346407.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 131 2e-28 gb|KHN29619.1| Pentatricopeptide repeat-containing protein, mito... 130 3e-28 ref|XP_006578120.1| PREDICTED: pentatricopeptide repeat-containi... 130 3e-28 ref|XP_004491447.1| PREDICTED: pentatricopeptide repeat-containi... 129 1e-27 ref|XP_012489272.1| PREDICTED: pentatricopeptide repeat-containi... 128 1e-27 gb|AET00634.2| PPR containing plant-like protein [Medicago trunc... 128 2e-27 ref|XP_003617675.1| Pentatricopeptide repeat-containing protein ... 128 2e-27 ref|XP_010087614.1| hypothetical protein L484_022141 [Morus nota... 125 8e-27 ref|XP_012702903.1| PREDICTED: pentatricopeptide repeat-containi... 125 1e-26 ref|XP_011623373.1| PREDICTED: pentatricopeptide repeat-containi... 125 1e-26 >ref|XP_010269295.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042613|ref|XP_010269296.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042616|ref|XP_010269297.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042619|ref|XP_010269298.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042622|ref|XP_010269299.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042625|ref|XP_010269300.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042628|ref|XP_010269301.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] gi|720042631|ref|XP_010269302.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nelumbo nucifera] Length = 784 Score = 138 bits (347), Expect = 2e-30 Identities = 60/82 (73%), Positives = 75/82 (91%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSGNL EAEAM+L+MP+ PDGGVWGALLGAC++H +VEMGER+A+ A E DP N Sbjct: 684 MVDLLGRSGNLREAEAMVLSMPIAPDGGVWGALLGACRMHNDVEMGERVAKWAIESDPGN 743 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYY+L+SNMY+S+G+W+DAE+ Sbjct: 744 DGYYVLLSNMYNSIGRWKDAEK 765 >ref|XP_010937492.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Elaeis guineensis] Length = 791 Score = 137 bits (344), Expect = 4e-30 Identities = 61/82 (74%), Positives = 72/82 (87%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 +VDLLGRSGNL EAEAM+L MP+ PD G+WGALLGAC++H NVEMGERIARRA E DPEN Sbjct: 688 IVDLLGRSGNLCEAEAMVLNMPMEPDSGIWGALLGACRMHNNVEMGERIARRALESDPEN 747 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 +GYYIL+SNMYS G+WE+ E+ Sbjct: 748 EGYYILLSNMYSCAGRWEEVEK 769 >ref|XP_009381501.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 779 Score = 137 bits (344), Expect = 4e-30 Identities = 62/81 (76%), Positives = 71/81 (87%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSG+L EAEAMIL MPV PDGG+WGALLGACKIH +V MGER+AR+AFE +PEN Sbjct: 679 MVDLLGRSGHLSEAEAMILKMPVKPDGGIWGALLGACKIHDDVAMGERVARKAFESEPEN 738 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYYILMSN+YS G+W + E Sbjct: 739 DGYYILMSNIYSHAGRWNEVE 759 >ref|XP_010662158.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422578|ref|XP_010662160.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422580|ref|XP_010662161.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422582|ref|XP_010662162.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422584|ref|XP_010662163.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] Length = 782 Score = 133 bits (335), Expect = 4e-29 Identities = 58/82 (70%), Positives = 72/82 (87%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSGNL EAEA++L+MP+ PDGGVWGALL +CKIH +EMG RIA+ A + D EN Sbjct: 682 MVDLLGRSGNLQEAEALVLSMPISPDGGVWGALLSSCKIHNEIEMGIRIAKHAIDSDVEN 741 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYY+++SNMYSS+GKWE+AE+ Sbjct: 742 DGYYVMISNMYSSIGKWEEAEK 763 >ref|XP_008802225.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Phoenix dactylifera] Length = 788 Score = 133 bits (335), Expect = 4e-29 Identities = 59/82 (71%), Positives = 70/82 (85%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 +VDLLGRSGNL EAEAM+L MP+ PD G+WG LLGAC++H N+EMGERIARRA E DP N Sbjct: 685 IVDLLGRSGNLCEAEAMVLNMPMEPDSGIWGVLLGACRMHNNMEMGERIARRALESDPTN 744 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYYIL+SNMYS G+WE+ E+ Sbjct: 745 DGYYILLSNMYSCAGRWEEVEK 766 >emb|CBI26593.3| unnamed protein product [Vitis vinifera] Length = 459 Score = 133 bits (335), Expect = 4e-29 Identities = 58/82 (70%), Positives = 72/82 (87%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSGNL EAEA++L+MP+ PDGGVWGALL +CKIH +EMG RIA+ A + D EN Sbjct: 359 MVDLLGRSGNLQEAEALVLSMPISPDGGVWGALLSSCKIHNEIEMGIRIAKHAIDSDVEN 418 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYY+++SNMYSS+GKWE+AE+ Sbjct: 419 DGYYVMISNMYSSIGKWEEAEK 440 >ref|XP_009370728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial, partial [Pyrus x bretschneideri] Length = 762 Score = 133 bits (334), Expect = 5e-29 Identities = 56/80 (70%), Positives = 71/80 (88%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVD+LGRSGNL EAE ++L+MP+ PDGGVWG+LLGACKIH +E+G R+AR A + DPEN Sbjct: 662 MVDILGRSGNLQEAEDLVLSMPISPDGGVWGSLLGACKIHNEIELGVRVARHAIKSDPEN 721 Query: 106 DGYYILMSNMYSSVGKWEDA 47 DGYYI++SN+YSS+GKWE+A Sbjct: 722 DGYYIMLSNLYSSIGKWEEA 741 >ref|XP_008234126.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Prunus mume] Length = 779 Score = 133 bits (334), Expect = 5e-29 Identities = 56/80 (70%), Positives = 71/80 (88%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVD+LGRSGNL EA+ ++L+MP+PPDGGVWG+LL ACKIH +E+G R+AR A E DPEN Sbjct: 679 MVDILGRSGNLQEAKDLVLSMPIPPDGGVWGSLLSACKIHNEIELGVRVARHAIESDPEN 738 Query: 106 DGYYILMSNMYSSVGKWEDA 47 DGYYI++SN+YSSVG+WE+A Sbjct: 739 DGYYIMLSNLYSSVGRWEEA 758 >ref|XP_007207635.1| hypothetical protein PRUPE_ppa021864mg [Prunus persica] gi|462403277|gb|EMJ08834.1| hypothetical protein PRUPE_ppa021864mg [Prunus persica] Length = 748 Score = 132 bits (333), Expect = 7e-29 Identities = 55/80 (68%), Positives = 71/80 (88%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVD+LGRSGNL EA+ ++L+MP+PPDGGVWG+LL ACKIH +E+G R+AR A E DPEN Sbjct: 648 MVDILGRSGNLQEAKDLVLSMPIPPDGGVWGSLLSACKIHNEIELGVRVARHAIESDPEN 707 Query: 106 DGYYILMSNMYSSVGKWEDA 47 DGYYI++SN+YSS+G+WE+A Sbjct: 708 DGYYIMLSNLYSSIGRWEEA 727 >emb|CAN64701.1| hypothetical protein VITISV_037299 [Vitis vinifera] Length = 1111 Score = 132 bits (332), Expect = 9e-29 Identities = 58/82 (70%), Positives = 71/82 (86%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSGNL EAEA++L+MP+ PDGGVWGALL +CKIH +EMG RIA+ A D EN Sbjct: 1011 MVDLLGRSGNLQEAEALVLSMPISPDGGVWGALLSSCKIHNEIEMGIRIAKHAIXSDVEN 1070 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYY+++SNMYSS+GKWE+AE+ Sbjct: 1071 DGYYVMISNMYSSIGKWEEAEK 1092 >ref|XP_008346407.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like [Malus domestica] Length = 781 Score = 131 bits (329), Expect = 2e-28 Identities = 54/80 (67%), Positives = 70/80 (87%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVD+LGRSGNL EAE ++L+MP+ PDGGVWG+LLGACKIH +E+G R+AR A + DPEN Sbjct: 681 MVDILGRSGNLQEAEDLVLSMPISPDGGVWGSLLGACKIHNEIELGVRVARHAIKSDPEN 740 Query: 106 DGYYILMSNMYSSVGKWEDA 47 DGYY+++SN+Y S+GKWE+A Sbjct: 741 DGYYVMLSNLYGSIGKWEEA 760 >gb|KHN29619.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 597 Score = 130 bits (328), Expect = 3e-28 Identities = 57/81 (70%), Positives = 70/81 (86%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGR GN+ EAEAM+L+MP+ PDGGVWGALLG CK H +EMG RIA+ A +L+PEN Sbjct: 496 MVDLLGRYGNVQEAEAMVLSMPISPDGGVWGALLGHCKTHNQIEMGIRIAKYAIDLEPEN 555 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYYI+M+NMYS +G+WE+AE Sbjct: 556 DGYYIIMANMYSFIGRWEEAE 576 >ref|XP_006578120.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like isoform X2 [Glycine max] gi|571449376|ref|XP_006578121.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like isoform X3 [Glycine max] gi|571449378|ref|XP_003522424.2| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like isoform X1 [Glycine max] gi|571449380|ref|XP_006578122.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like isoform X4 [Glycine max] gi|571449382|ref|XP_006578123.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like isoform X5 [Glycine max] gi|571449384|ref|XP_006578124.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like isoform X6 [Glycine max] Length = 754 Score = 130 bits (328), Expect = 3e-28 Identities = 57/81 (70%), Positives = 70/81 (86%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGR GN+ EAEAM+L+MP+ PDGGVWGALLG CK H +EMG RIA+ A +L+PEN Sbjct: 653 MVDLLGRYGNVQEAEAMVLSMPISPDGGVWGALLGHCKTHNQIEMGIRIAKYAIDLEPEN 712 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYYI+M+NMYS +G+WE+AE Sbjct: 713 DGYYIIMANMYSFIGRWEEAE 733 >ref|XP_004491447.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cicer arietinum] gi|502099305|ref|XP_004491448.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cicer arietinum] gi|828296591|ref|XP_012568670.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cicer arietinum] gi|828296593|ref|XP_012568671.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cicer arietinum] Length = 760 Score = 129 bits (323), Expect = 1e-27 Identities = 55/81 (67%), Positives = 70/81 (86%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSGNL+EAE ++L+MP+ PDGGVWGALL ACK H +EMG RI + A + +PEN Sbjct: 659 MVDLLGRSGNLEEAEELVLSMPISPDGGVWGALLSACKTHNQIEMGIRIGKYAIDSEPEN 718 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYYI+++NMYSS+G+WE+AE Sbjct: 719 DGYYIMVANMYSSIGRWEEAE 739 >ref|XP_012489272.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184664|ref|XP_012489273.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184667|ref|XP_012489274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184670|ref|XP_012489275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184673|ref|XP_012489276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184676|ref|XP_012489277.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184679|ref|XP_012489278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184682|ref|XP_012489279.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|763773244|gb|KJB40367.1| hypothetical protein B456_007G060400 [Gossypium raimondii] gi|763773245|gb|KJB40368.1| hypothetical protein B456_007G060400 [Gossypium raimondii] gi|763773246|gb|KJB40369.1| hypothetical protein B456_007G060400 [Gossypium raimondii] gi|763773247|gb|KJB40370.1| hypothetical protein B456_007G060400 [Gossypium raimondii] Length = 785 Score = 128 bits (322), Expect = 1e-27 Identities = 56/82 (68%), Positives = 70/82 (85%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 M DLLGRSGNL EAEA+++++P+ PDGGVWGALL +C +H EMG RIA+RA + DPEN Sbjct: 685 MTDLLGRSGNLQEAEALVMSLPISPDGGVWGALLSSCLVHNETEMGIRIAKRAIDSDPEN 744 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYYIL+SNMYSS+G WE+AE+ Sbjct: 745 DGYYILISNMYSSMGWWEEAER 766 >gb|AET00634.2| PPR containing plant-like protein [Medicago truncatula] Length = 759 Score = 128 bits (321), Expect = 2e-27 Identities = 54/81 (66%), Positives = 70/81 (86%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRS NL+EAE ++L+MP+PPDGGVWGALL ACK H +EMG RI + A + +PEN Sbjct: 658 MVDLLGRSCNLEEAEELVLSMPIPPDGGVWGALLSACKTHNQIEMGIRIGKNAIDSEPEN 717 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYYI+++NMYSS+G+W++AE Sbjct: 718 DGYYIMVANMYSSIGRWDEAE 738 >ref|XP_003617675.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 758 Score = 128 bits (321), Expect = 2e-27 Identities = 54/81 (66%), Positives = 70/81 (86%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRS NL+EAE ++L+MP+PPDGGVWGALL ACK H +EMG RI + A + +PEN Sbjct: 657 MVDLLGRSCNLEEAEELVLSMPIPPDGGVWGALLSACKTHNQIEMGIRIGKNAIDSEPEN 716 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYYI+++NMYSS+G+W++AE Sbjct: 717 DGYYIMVANMYSSIGRWDEAE 737 >ref|XP_010087614.1| hypothetical protein L484_022141 [Morus notabilis] gi|587838780|gb|EXB29469.1| hypothetical protein L484_022141 [Morus notabilis] Length = 778 Score = 125 bits (315), Expect = 8e-27 Identities = 57/81 (70%), Positives = 67/81 (82%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGRSGNL EAEA++L+MPV PDGGVWG+LL AC H +MG R+ARRA E DP N Sbjct: 678 MVDLLGRSGNLQEAEALVLSMPVSPDGGVWGSLLSACIKHNQNDMGVRVARRAIESDPGN 737 Query: 106 DGYYILMSNMYSSVGKWEDAE 44 DGYY+++SNMYSS G+WE AE Sbjct: 738 DGYYVMLSNMYSSSGRWEQAE 758 >ref|XP_012702903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Setaria italica] Length = 772 Score = 125 bits (314), Expect = 1e-26 Identities = 57/82 (69%), Positives = 66/82 (80%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLG+SG+L EAE M+L MPV PDGGVWG LL ACK+H N EMG RIA++AF DPEN Sbjct: 668 MVDLLGKSGHLQEAEDMVLAMPVEPDGGVWGTLLSACKVHDNFEMGLRIAQKAFASDPEN 727 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYYILMSN Y S KW++ E+ Sbjct: 728 DGYYILMSNSYGSAKKWDEIEK 749 >ref|XP_011623373.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Amborella trichopoda] Length = 884 Score = 125 bits (313), Expect = 1e-26 Identities = 53/82 (64%), Positives = 68/82 (82%) Frame = -3 Query: 286 MVDLLGRSGNLDEAEAMILTMPVPPDGGVWGALLGACKIHGNVEMGERIARRAFELDPEN 107 MVDLLGR+GNLDEA +I MP+ PD G+WGALLGACKIHG +E+GE++A F+LDP N Sbjct: 738 MVDLLGRAGNLDEANELINAMPMAPDHGIWGALLGACKIHGEIELGEQVAEHLFQLDPNN 797 Query: 106 DGYYILMSNMYSSVGKWEDAEQ 41 DGYYIL+SN+Y+S +W DA++ Sbjct: 798 DGYYILLSNIYASAKRWRDAQR 819