BLASTX nr result
ID: Cinnamomum23_contig00035544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00035544 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009052226.1| hypothetical protein AaV_151 [Aureococcus an... 79 2e-12 ref|YP_009052317.1| hypothetical protein AaV_243 [Aureococcus an... 67 5e-09 ref|YP_007676151.1| hypothetical protein MPVG_00083 [Micromonas ... 60 7e-07 >ref|YP_009052226.1| hypothetical protein AaV_151 [Aureococcus anophagefferens virus] gi|669205258|gb|AII16956.1| hypothetical protein AaV_151 [Aureococcus anophagefferens virus] Length = 238 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/83 (44%), Positives = 57/83 (68%), Gaps = 1/83 (1%) Frame = -2 Query: 336 NKYPPTFSLKLLKNNDGGFQCEVFNEKKQKIE-LTEENSKNARITSLLKLGGIWVVGNKF 160 +KYPPTF LK+ N DG F+ FNEKK++++ L + SK + S++KL G+W+ G K Sbjct: 130 DKYPPTFKLKVA-NYDGKFKALCFNEKKEQMQDLADAISKGMMLRSIVKLTGVWLAGGKC 188 Query: 159 GLTWNVLQLRLQPPSKITGYAFK 91 G TW +LQ+++ P ++G+AFK Sbjct: 189 GTTWELLQVQVPPQLSVSGFAFK 211 >ref|YP_009052317.1| hypothetical protein AaV_243 [Aureococcus anophagefferens virus] gi|669205362|gb|AII17060.1| hypothetical protein AaV_243 [Aureococcus anophagefferens virus] Length = 212 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/85 (37%), Positives = 52/85 (61%), Gaps = 3/85 (3%) Frame = -2 Query: 339 NNKYPPTFSLKLLKNNDGGFQCEVFNEKKQKIELTEEN-SKNARITSLLKLGGIWVVGNK 163 NN YPP LK+ N+ F C VFN ++++I+ E +N + ++K GIW+ G K Sbjct: 126 NNNYPPNLRLKIPYYNEK-FNCSVFNHERERIDDFEAKLERNTKAFCVVKCLGIWIAGGK 184 Query: 162 FGLTWNVLQLRLQPP--SKITGYAF 94 FG+ W V Q++L+ P +K+ G++F Sbjct: 185 FGINWQVSQIKLEKPIENKLAGFSF 209 >ref|YP_007676151.1| hypothetical protein MPVG_00083 [Micromonas pusilla virus 12T] gi|468639768|gb|AGH30906.1| hypothetical protein MPVG_00083 [Micromonas pusilla virus 12T] Length = 237 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/83 (31%), Positives = 50/83 (60%) Frame = -2 Query: 333 KYPPTFSLKLLKNNDGGFQCEVFNEKKQKIELTEENSKNARITSLLKLGGIWVVGNKFGL 154 +YP T LK+L +DG F E ++ K++++ L + K ++ +++ L IW + NKFG+ Sbjct: 130 QYPATMKLKILTKSDGSFVPEAYSMKRERVSL-DTVEKGQKVVAIIDLNQIWFIDNKFGV 188 Query: 153 TWNVLQLRLQPPSKITGYAFKSV 85 T + Q+ L+ K+ +AF+ + Sbjct: 189 TIRLQQVLLEQSEKLPSFAFQGL 211