BLASTX nr result
ID: Cinnamomum23_contig00035374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00035374 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD83485.2| hypothetical protein (mitochondrion) [Nicotiana ... 84 5e-15 ref|YP_173421.1| hypothetical protein NitaMp079 [Nicotiana tabac... 82 2e-14 ref|YP_009121965.1| ribosomal protein S1 (mitochondrion) [Hyoscy... 82 2e-14 pir||S42982 hypothetical protein 224 - evening primrose mitochon... 77 4e-14 emb|CAN65168.1| hypothetical protein VITISV_029402 [Vitis vinifera] 82 1e-13 ref|YP_009049649.1| hypothetical protein (mitochondrion) [Capsic... 80 5e-13 gb|AIG89908.1| hypothetical protein (mitochondrion) [Capsicum an... 80 5e-13 ref|YP_006666127.1| ribosomal protein S1 (mitochondrion) [Malus ... 78 2e-12 ref|YP_009041174.1| ribosomal protein S1 (mitochondrion) [Rhazya... 78 3e-12 gb|AKJ25848.1| ribosomal protein S1 (mitochondrion) [Melianthus ... 76 1e-11 gb|AKJ25829.1| ribosomal protein S1 (mitochondrion) [Francoa son... 76 1e-11 ref|YP_003587248.2| ribosomal protein S1 [Citrullus lanatus] gi|... 76 1e-11 ref|YP_004237279.1| ribosomal protein S1 (mitochondrion) [Ricinu... 74 4e-11 ref|YP_009045794.1| ribosomal protein S1 (mitochondrion) [Batis ... 73 7e-11 ref|YP_008802503.1| ribosomal protein S1 (mitochondrion) (mitoch... 73 7e-11 ref|YP_006291816.1| rps1 gene product (mitochondrion) [Daucus ca... 73 9e-11 ref|YP_007905701.1| ribosomal protein S1 (mitochondrion) [Liriod... 72 1e-10 ref|YP_003587379.2| ribosomal protein S1 [Cucurbita pepo] gi|313... 72 1e-10 ref|YP_002608219.1| ribosomal protein S1 [Carica papaya] gi|1705... 71 3e-10 gb|AHA47130.1| ribosomal protein S1 (mitochondrion) [Amborella t... 71 3e-10 >dbj|BAD83485.2| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 216 Score = 84.0 bits (206), Expect(2) = 5e-15 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 149 KRRN*KKTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 +R KK MMSIYLSRLFPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 8 RRGGKKKLMMSIYLSRLFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 56 Score = 23.5 bits (49), Expect(2) = 5e-15 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 172 MLLINSTGRGGIKK 131 MLLIN T RGG KK Sbjct: 1 MLLINRTRRGGKKK 14 >ref|YP_173421.1| hypothetical protein NitaMp079 [Nicotiana tabacum] gi|756762096|gb|AJM70205.1| ribosomal protein S1 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] Length = 216 Score = 81.6 bits (200), Expect(2) = 2e-14 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -1 Query: 149 KRRN*KKTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 +R KK MMSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 8 RRGGKKKLMMSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 56 Score = 23.5 bits (49), Expect(2) = 2e-14 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 172 MLLINSTGRGGIKK 131 MLLIN T RGG KK Sbjct: 1 MLLINRTRRGGKKK 14 >ref|YP_009121965.1| ribosomal protein S1 (mitochondrion) [Hyoscyamus niger] gi|756142182|gb|AJK91393.1| ribosomal protein S1 (mitochondrion) [Hyoscyamus niger] Length = 216 Score = 81.6 bits (200), Expect(2) = 2e-14 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -1 Query: 149 KRRN*KKTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 +R KK MMSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 8 RRGGKKKLMMSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 56 Score = 23.5 bits (49), Expect(2) = 2e-14 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 172 MLLINSTGRGGIKK 131 MLLIN T RGG KK Sbjct: 1 MLLINRTRRGGKKK 14 >pir||S42982 hypothetical protein 224 - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] gi|459533|emb|CAA54968.1| rps1 (mitochondrion) [Oenothera berteroana] Length = 224 Score = 77.0 bits (188), Expect(2) = 4e-14 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 134 KKTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 KK +MSIYLSR F RSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 14 KKQLMSIYLSRSFTRSNSSFFLCSGNALQSEVLRLREEMFLVDA 57 Score = 27.3 bits (59), Expect(2) = 4e-14 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 172 MLLINSTGRGGIKKR 128 MLLIN TGRGG KK+ Sbjct: 1 MLLINRTGRGGKKKK 15 >emb|CAN65168.1| hypothetical protein VITISV_029402 [Vitis vinifera] Length = 217 Score = 82.4 bits (202), Expect = 1e-13 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -1 Query: 152 RKRRN*KKTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 ++R+ KK MMSIYLSR FPRSNSSFFLCSGNA QS+VLRLREEMFLVDA Sbjct: 7 KRRKKIKKLMMSIYLSRSFPRSNSSFFLCSGNASQSSVLRLREEMFLVDA 56 >ref|YP_009049649.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751921|gb|AIG90007.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 152 Score = 80.1 bits (196), Expect = 5e-13 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = -1 Query: 131 KTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 K MMSIYLSRLFPRSNSSFFLC GNALQS VLRLREEMFLVDA Sbjct: 8 KVMMSIYLSRLFPRSNSSFFLCRGNALQSEVLRLREEMFLVDA 50 >gb|AIG89908.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 141 Score = 80.1 bits (196), Expect = 5e-13 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = -1 Query: 131 KTMMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 K MMSIYLSRLFPRSNSSFFLC GNALQS VLRLREEMFLVDA Sbjct: 8 KVMMSIYLSRLFPRSNSSFFLCRGNALQSEVLRLREEMFLVDA 50 >ref|YP_006666127.1| ribosomal protein S1 (mitochondrion) [Malus domestica] gi|401661930|emb|CBX33386.1| rps1 (mitochondrion) [Malus domestica] Length = 202 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 125 MMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MMSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 1 MMSIYLSRAFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 41 >ref|YP_009041174.1| ribosomal protein S1 (mitochondrion) [Rhazya stricta] gi|651729778|ref|YP_009041193.1| ribosomal protein S1 (mitochondrion) [Rhazya stricta] gi|645929298|gb|AIB08821.1| ribosomal protein S1 (mitochondrion) [Rhazya stricta] gi|645929317|gb|AIB08840.1| ribosomal protein S1 (mitochondrion) [Rhazya stricta] Length = 198 Score = 77.8 bits (190), Expect = 3e-12 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 125 MMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MMSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 1 MMSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 41 >gb|AKJ25848.1| ribosomal protein S1 (mitochondrion) [Melianthus villosus] Length = 201 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 40 >gb|AKJ25829.1| ribosomal protein S1 (mitochondrion) [Francoa sonchifolia] Length = 201 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 40 >ref|YP_003587248.2| ribosomal protein S1 [Citrullus lanatus] gi|313354145|gb|ACV96647.2| ribosomal protein S1 [Citrullus lanatus] Length = 211 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVDA 40 >ref|YP_004237279.1| ribosomal protein S1 (mitochondrion) [Ricinus communis] gi|322394286|gb|ADW96043.1| ribosomal protein S1 (mitochondrion) [Ricinus communis] Length = 201 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGNALQS VLRLREEMFLV+A Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEMFLVNA 40 >ref|YP_009045794.1| ribosomal protein S1 (mitochondrion) [Batis maritima] gi|655168568|gb|AIC83397.1| ribosomal protein S1 (mitochondrion) (mitochondrion) [Batis maritima] Length = 196 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGN LQS VLRLREEMFL+DA Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNTLQSEVLRLREEMFLLDA 40 >ref|YP_008802503.1| ribosomal protein S1 (mitochondrion) (mitochondrion) [Asclepias syriaca] gi|556562341|gb|AGZ63037.1| ribosomal protein S1 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 193 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGNALQS VL LREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNALQSEVLPLREEMFLVDA 40 >ref|YP_006291816.1| rps1 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|386799258|ref|YP_006291851.1| rps1 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|386799265|ref|YP_006291865.1| rps1 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081943|gb|AEY81135.1| ribosomal protein S1 (mitochondrion) [Daucus carota subsp. sativus] gi|374081961|gb|AEY81153.1| ribosomal protein S1 (mitochondrion) [Daucus carota subsp. sativus] gi|374081968|gb|AEY81160.1| ribosomal protein S1 (mitochondrion) [Daucus carota subsp. sativus] Length = 208 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 125 MMSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MM+IYLSR FPRSNSSFFLCSGNALQS VLRLRE++FL+DA Sbjct: 1 MMTIYLSRSFPRSNSSFFLCSGNALQSEVLRLREDIFLMDA 41 >ref|YP_007905701.1| ribosomal protein S1 (mitochondrion) [Liriodendron tulipifera] gi|480541904|gb|AGJ90397.1| ribosomal protein S1 (mitochondrion) [Liriodendron tulipifera] Length = 201 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSF LCSGNA QSAVLRLREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFCLCSGNASQSAVLRLREEMFLVDA 40 >ref|YP_003587379.2| ribosomal protein S1 [Cucurbita pepo] gi|313354146|gb|ACV96689.2| ribosomal protein S1 [Cucurbita pepo] Length = 201 Score = 72.0 bits (175), Expect = 1e-10 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFL SGNALQS+VLRLREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFFLRSGNALQSSVLRLREEMFLVDA 40 >ref|YP_002608219.1| ribosomal protein S1 [Carica papaya] gi|170522398|gb|ACB20508.1| ribosomal protein S1 (mitochondrion) [Carica papaya] Length = 200 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSFFLCSGNALQS VLRLREE+ LVDA Sbjct: 1 MSIYLSRSFPRSNSSFFLCSGNALQSEVLRLREEICLVDA 40 >gb|AHA47130.1| ribosomal protein S1 (mitochondrion) [Amborella trichopoda] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -1 Query: 122 MSIYLSRLFPRSNSSFFLCSGNALQSAVLRLREEMFLVDA 3 MSIYLSR FPRSNSSF LCSGNA QS VLRLREEMFLVDA Sbjct: 1 MSIYLSRSFPRSNSSFLLCSGNASQSKVLRLREEMFLVDA 40