BLASTX nr result
ID: Cinnamomum23_contig00035193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00035193 (289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM94693.1| hypothetical protein AMTR_s00011p00232900 [Ambore... 77 4e-12 >gb|ERM94693.1| hypothetical protein AMTR_s00011p00232900 [Amborella trichopoda] Length = 156 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/60 (56%), Positives = 46/60 (76%) Frame = -3 Query: 182 EDYIQRGKMEIGVDMRLLPAMLLMGEHLPDHLLQHLDSRSRIHDCLSFFLRLLIDVKTVE 3 E+Y+ GK +GVDMR++P + LMGE + DH++Q LDSRS+I+D L F+RL IDVKT E Sbjct: 2 EEYMSHGKASLGVDMRIVPVLFLMGERIQDHVIQQLDSRSKIYDQLCTFMRLFIDVKTFE 61