BLASTX nr result
ID: Cinnamomum23_contig00034944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00034944 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009391177.1| PREDICTED: high mobility group B protein 9-l... 59 2e-06 >ref|XP_009391177.1| PREDICTED: high mobility group B protein 9-like [Musa acuminata subsp. malaccensis] Length = 352 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 219 YNACGLKDKERYKREMQEYKERMKLVQHKEAARAGPS 109 Y GLKDKERYKREMQEYKER+KLVQ KE A A PS Sbjct: 301 YQNYGLKDKERYKREMQEYKERLKLVQPKEMAGAEPS 337