BLASTX nr result
ID: Cinnamomum23_contig00034805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00034805 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citr... 124 3e-26 ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 ref|XP_011040332.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 ref|XP_008362581.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 ref|XP_006374591.1| ubiquitin/ribosomal protein 27a [Populus tri... 123 4e-26 ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S... 123 4e-26 emb|CAN80663.1| hypothetical protein VITISV_036195 [Vitis vinifera] 123 4e-26 ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [S... 123 4e-26 gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis] 123 6e-26 ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S... 122 9e-26 ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S... 122 9e-26 ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S... 122 9e-26 ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S... 122 9e-26 gb|KJB49764.1| hypothetical protein B456_008G136200, partial [Go... 122 1e-25 gb|KJB06862.1| hypothetical protein B456_001G146500 [Gossypium r... 122 1e-25 gb|AIX10775.1| ubiquitin, partial [Panax notoginseng] 122 1e-25 ref|XP_010040181.1| PREDICTED: ubiquitin-40S ribosomal protein S... 122 1e-25 >ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citrus clementina] gi|557526422|gb|ESR37728.1| hypothetical protein CICLE_v10029476mg [Citrus clementina] Length = 156 Score = 124 bits (310), Expect = 3e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGSD 156 >ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus euphratica] Length = 202 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 146 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 202 >ref|XP_011040332.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus euphratica] Length = 156 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus grandis] Length = 232 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 176 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 232 >ref|XP_008362581.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial [Malus domestica] Length = 115 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 59 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 115 >ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] gi|657995096|ref|XP_008389867.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] gi|658015739|ref|XP_008343199.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] gi|658031012|ref|XP_008350959.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] gi|658036648|ref|XP_008353873.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] gi|658050002|ref|XP_008360710.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] gi|694370697|ref|XP_009363083.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] gi|694382295|ref|XP_009367168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] gi|694402369|ref|XP_009376181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] Length = 156 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus sinensis] Length = 164 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 108 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 164 >ref|XP_006374591.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa] gi|550322560|gb|ERP52388.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa] Length = 156 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] Length = 156 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >emb|CAN80663.1| hypothetical protein VITISV_036195 [Vitis vinifera] Length = 156 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [Solanum tuberosum] gi|224053300|ref|XP_002297752.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa] gi|224064701|ref|XP_002301539.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa] gi|255548313|ref|XP_002515213.1| ubiquitin, putative [Ricinus communis] gi|460415200|ref|XP_004252948.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum lycopersicum] gi|460415202|ref|XP_004252949.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum lycopersicum] gi|460415204|ref|XP_004252950.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum lycopersicum] gi|566197977|ref|XP_006376957.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa] gi|567891617|ref|XP_006438329.1| hypothetical protein CICLE_v10032969mg [Citrus clementina] gi|568860792|ref|XP_006483898.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus sinensis] gi|590694766|ref|XP_007044700.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma cacao] gi|596110733|ref|XP_007221513.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica] gi|596198274|ref|XP_007223652.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica] gi|645243044|ref|XP_008227802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Prunus mume] gi|697110711|ref|XP_009609224.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana tomentosiformis] gi|697110713|ref|XP_009609225.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana tomentosiformis] gi|697110715|ref|XP_009609226.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana tomentosiformis] gi|698572220|ref|XP_009775091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana sylvestris] gi|698572224|ref|XP_009775093.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana sylvestris] gi|702277030|ref|XP_010044607.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eucalyptus grandis] gi|743911513|ref|XP_010999619.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Populus euphratica] gi|1771780|emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum] gi|76573361|gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum] gi|118481233|gb|ABK92566.1| unknown [Populus trichocarpa] gi|118484030|gb|ABK93901.1| unknown [Populus trichocarpa] gi|118484734|gb|ABK94236.1| unknown [Populus trichocarpa] gi|118484740|gb|ABK94239.1| unknown [Populus trichocarpa] gi|118484834|gb|ABK94284.1| unknown [Populus trichocarpa] gi|196166892|gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba] gi|222843265|gb|EEE80812.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa] gi|222845010|gb|EEE82557.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa] gi|223545693|gb|EEF47197.1| ubiquitin, putative [Ricinus communis] gi|462418263|gb|EMJ22712.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica] gi|462420588|gb|EMJ24851.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica] gi|508708635|gb|EOY00532.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma cacao] gi|550326892|gb|ERP54754.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa] gi|557540525|gb|ESR51569.1| hypothetical protein CICLE_v10032969mg [Citrus clementina] gi|629122209|gb|KCW86699.1| hypothetical protein EUGRSUZ_B03309 [Eucalyptus grandis] gi|641841318|gb|KDO60231.1| hypothetical protein CISIN_1g031613mg [Citrus sinensis] gi|661897003|emb|CDO98715.1| unnamed protein product [Coffea canephora] Length = 156 Score = 123 bits (309), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis] Length = 156 Score = 123 bits (308), Expect = 6e-26 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LA+LQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis guineensis] Length = 232 Score = 122 bits (306), Expect = 9e-26 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKV RLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAGD+ Sbjct: 176 LAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGDE 232 >ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica] Length = 156 Score = 122 bits (306), Expect = 9e-26 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQ+AG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQRAGGD 156 >ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca subsp. vesca] gi|470122728|ref|XP_004297391.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca subsp. vesca] gi|353259707|gb|AEQ75492.1| ubiquitin extension protein [Rosa multiflora] Length = 156 Score = 122 bits (306), Expect = 9e-26 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQ+LRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQKLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] gi|147836392|emb|CAN75420.1| hypothetical protein VITISV_037877 [Vitis vinifera] Length = 156 Score = 122 bits (306), Expect = 9e-26 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPN++CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNSECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156 >gb|KJB49764.1| hypothetical protein B456_008G136200, partial [Gossypium raimondii] Length = 210 Score = 122 bits (305), Expect = 1e-25 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVD+SGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 154 LAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 210 >gb|KJB06862.1| hypothetical protein B456_001G146500 [Gossypium raimondii] Length = 183 Score = 122 bits (305), Expect = 1e-25 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVD+SGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 127 LAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 183 >gb|AIX10775.1| ubiquitin, partial [Panax notoginseng] Length = 155 Score = 122 bits (305), Expect = 1e-25 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKV+DSGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 99 LAVLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 155 >ref|XP_010040181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus grandis] gi|629078364|gb|KCW45422.1| hypothetical protein EUGRSUZ_L00891 [Eucalyptus grandis] Length = 156 Score = 122 bits (305), Expect = 1e-25 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 194 LAVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGDD 24 LAVLQFYKVDDSGKVQRLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVYQKAG D Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNGECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD 156