BLASTX nr result
ID: Cinnamomum23_contig00034524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00034524 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934723.1| PREDICTED: proliferating cell nuclear antige... 62 1e-07 ref|XP_010262728.1| PREDICTED: proliferating cell nuclear antige... 61 3e-07 ref|XP_006827712.1| PREDICTED: proliferating cell nuclear antige... 61 3e-07 ref|XP_010256721.1| PREDICTED: proliferating cell nuclear antige... 60 4e-07 ref|NP_001234844.1| proliferating cell nuclear antigen [Solanum ... 60 6e-07 ref|XP_010934724.1| PREDICTED: proliferating cell nuclear antige... 60 7e-07 emb|CDX86490.1| BnaC08g02130D [Brassica napus] 59 1e-06 ref|XP_010033044.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 gb|ADA70357.1| proliferation cell nuclear antigen [Persea americ... 59 1e-06 ref|XP_009624180.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 ref|XP_011035213.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 ref|XP_009778764.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 ref|XP_009374304.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 emb|CDP09138.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_008464069.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 ref|XP_008344780.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 ref|XP_008355484.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 ref|XP_002298328.1| proliferating cell nuclear antigen family pr... 59 1e-06 ref|NP_001105461.1| proliferating cell nuclear antigen [Zea mays... 59 1e-06 ref|XP_004294249.1| PREDICTED: proliferating cell nuclear antige... 59 1e-06 >ref|XP_010934723.1| PREDICTED: proliferating cell nuclear antigen-like isoform X1 [Elaeis guineensis] Length = 275 Score = 62.0 bits (149), Expect = 1e-07 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS*LCEMSF 201 PL SDLPVVVEYKIAEMGY+R+YLAPKIEDD+E L E SF Sbjct: 220 PLSSTVTISMSSDLPVVVEYKIAEMGYIRFYLAPKIEDDDEGYILEEKSF 269 >ref|XP_010262728.1| PREDICTED: proliferating cell nuclear antigen [Nelumbo nucifera] Length = 264 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL SDLP+VVEYKIAEMGY+R+YLAPKIED+EE+S Sbjct: 220 PLSGTVTISLSSDLPIVVEYKIAEMGYIRFYLAPKIEDEEEES 262 >ref|XP_006827712.1| PREDICTED: proliferating cell nuclear antigen [Amborella trichopoda] gi|548832332|gb|ERM95128.1| hypothetical protein AMTR_s00009p00259890 [Amborella trichopoda] Length = 262 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL SDLP+VVEYKIA+MGYLR+YLAPKIED+EEQS Sbjct: 220 PLSNSVSLSMSSDLPLVVEYKIADMGYLRFYLAPKIEDEEEQS 262 >ref|XP_010256721.1| PREDICTED: proliferating cell nuclear antigen-like [Nelumbo nucifera] Length = 266 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL SDLPVVVEYKIAEMGY+R+YLAPKIED+EE++ Sbjct: 220 PLSNTVTISLSSDLPVVVEYKIAEMGYIRFYLAPKIEDEEEET 262 >ref|NP_001234844.1| proliferating cell nuclear antigen [Solanum lycopersicum] gi|565368361|ref|XP_006350815.1| PREDICTED: proliferating cell nuclear antigen-like [Solanum tuberosum] gi|25005275|emb|CAD56690.1| proliferating cell nuclear antigen [Solanum lycopersicum] Length = 264 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+RYYLAPKIE+DEE++ Sbjct: 220 PLSNTVTISLSSELPVVVEYKIAEMGYVRYYLAPKIEEDEEET 262 >ref|XP_010934724.1| PREDICTED: proliferating cell nuclear antigen-like isoform X2 [Elaeis guineensis] Length = 263 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEE 228 PL SDLPVVVEYKIAEMGY+R+YLAPKIEDD+E Sbjct: 220 PLSSTVTISMSSDLPVVVEYKIAEMGYIRFYLAPKIEDDDE 260 >emb|CDX86490.1| BnaC08g02130D [Brassica napus] Length = 69 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYK+AEMGY+RYYLAPKIE+DEE + Sbjct: 9 PLSDRVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEDEEDT 51 >ref|XP_010033044.1| PREDICTED: proliferating cell nuclear antigen [Eucalyptus grandis] gi|629086222|gb|KCW52579.1| hypothetical protein EUGRSUZ_J01951 [Eucalyptus grandis] Length = 264 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL SDLPVVVEYKIAEMGY+R+YLAPKIE+DE+++ Sbjct: 220 PLSNTVTISLSSDLPVVVEYKIAEMGYIRFYLAPKIEEDEDET 262 >gb|ADA70357.1| proliferation cell nuclear antigen [Persea americana] Length = 290 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEE 228 PL S+LPVVVEYKIAEMGY+R+YLAPKIEDDEE Sbjct: 220 PLANSVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEDDEE 260 >ref|XP_009624180.1| PREDICTED: proliferating cell nuclear antigen [Nicotiana tomentosiformis] gi|6225836|sp|O82797.1|PCNA_TOBAC RecName: Full=Proliferating cell nuclear antigen; Short=PCNA [Nicotiana tabacum] gi|3366661|gb|AAC27992.1| proliferating cell nuclear antigen [Nicotiana tabacum] gi|3514105|gb|AAC34126.1| proliferating cell nuclear antigen [Nicotiana tabacum] gi|4586306|dbj|BAA76349.1| proliferating cell nuclear antigen [Nicotiana tabacum] Length = 264 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+R+YLAPKIE+DEE++ Sbjct: 220 PLSNTVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEEDEEET 262 >ref|XP_011035213.1| PREDICTED: proliferating cell nuclear antigen [Populus euphratica] Length = 268 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+RYYLAPKIE+DE+++ Sbjct: 220 PLSNTVKISLSSELPVVVEYKIAEMGYVRYYLAPKIEEDEDEN 262 >ref|XP_009778764.1| PREDICTED: proliferating cell nuclear antigen [Nicotiana sylvestris] Length = 264 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+R+YLAPKIE+DEE++ Sbjct: 220 PLSNTVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEEDEEET 262 >ref|XP_009374304.1| PREDICTED: proliferating cell nuclear antigen [Pyrus x bretschneideri] Length = 266 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -1 Query: 314 DLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 +LPVVVEYKIAEMGY+R+YLAPKIEDDE+++ Sbjct: 232 ELPVVVEYKIAEMGYIRFYLAPKIEDDEDET 262 >emb|CDP09138.1| unnamed protein product [Coffea canephora] Length = 264 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+R+YLAPKIE+DEE++ Sbjct: 220 PLSNTVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEEDEEET 262 >ref|XP_008464069.1| PREDICTED: proliferating cell nuclear antigen [Cucumis melo] Length = 266 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL SDLPVVVEYKIAEMGY+R+YLAPKIE+DE+++ Sbjct: 220 PLSNTVTISLSSDLPVVVEYKIAEMGYVRFYLAPKIEEDEDET 262 >ref|XP_008344780.1| PREDICTED: proliferating cell nuclear antigen [Malus domestica] Length = 151 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -1 Query: 314 DLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 +LPVVVEYKIAEMGY+R+YLAPKIEDDE+++ Sbjct: 117 ELPVVVEYKIAEMGYIRFYLAPKIEDDEDET 147 >ref|XP_008355484.1| PREDICTED: proliferating cell nuclear antigen [Malus domestica] Length = 266 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -1 Query: 314 DLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 +LPVVVEYKIAEMGY+R+YLAPKIEDDE+++ Sbjct: 232 ELPVVVEYKIAEMGYIRFYLAPKIEDDEDET 262 >ref|XP_002298328.1| proliferating cell nuclear antigen family protein [Populus trichocarpa] gi|222845586|gb|EEE83133.1| proliferating cell nuclear antigen family protein [Populus trichocarpa] Length = 268 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+RYYLAPKIE+DE+++ Sbjct: 220 PLSNTVKISLSSELPVVVEYKIAEMGYVRYYLAPKIEEDEDEN 262 >ref|NP_001105461.1| proliferating cell nuclear antigen [Zea mays] gi|2499442|sp|Q43266.1|PCNA_MAIZE RecName: Full=Proliferating cell nuclear antigen; Short=PCNA gi|732990|emb|CAA55669.1| proliferative cell nuclear antigen [Zea mays] gi|219887189|gb|ACL53969.1| unknown [Zea mays] gi|413939373|gb|AFW73924.1| proliferating cell nuclear antigen1 [Zea mays] gi|1093954|prf||2105195A proliferating cell nuclear antigen Length = 263 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 314 DLPVVVEYKIAEMGYLRYYLAPKIEDDEE 228 +LPVVVEYKIAEMGY+R+YLAPKIEDDEE Sbjct: 232 ELPVVVEYKIAEMGYIRFYLAPKIEDDEE 260 >ref|XP_004294249.1| PREDICTED: proliferating cell nuclear antigen [Fragaria vesca subsp. vesca] Length = 266 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 350 PLXXXXXXXXXSDLPVVVEYKIAEMGYLRYYLAPKIEDDEEQS 222 PL S+LPVVVEYKIAEMGY+R+YLAPKIE+DEE++ Sbjct: 220 PLSNTVTISLSSELPVVVEYKIAEMGYIRFYLAPKIEEDEEET 262