BLASTX nr result
ID: Cinnamomum23_contig00034311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00034311 (644 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB51869.1| hypothetical protein B456_008G235500 [Gossypium r... 58 4e-06 >gb|KJB51869.1| hypothetical protein B456_008G235500 [Gossypium raimondii] Length = 113 Score = 58.2 bits (139), Expect = 4e-06 Identities = 37/99 (37%), Positives = 58/99 (58%), Gaps = 4/99 (4%) Frame = -3 Query: 597 SHCPGPVFAALLWSFALKIPLS-GCISRACTRFSVSSVLILFRLSQVLFQEQ--SIRHGH 427 SH P+ A+L+ SF LKI + R ++ L F+LSQ+ + + +GH Sbjct: 17 SHSASPLIASLICSFLLKISSRLSVLRRVYIDVFHATRLFFFQLSQIALEADHPASSNGH 76 Query: 426 RWERALRVLCERAYVTR-RRISTAQSHETSLHSVSMLAL 313 RW+RALR++C+R +T RR A+S E S H+++ML+L Sbjct: 77 RWQRALRLVCQR--ITHVRRSPPAESDEASFHTLTMLSL 113