BLASTX nr result
ID: Cinnamomum23_contig00034141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00034141 (482 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 60 6e-07 ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phas... 60 7e-07 ref|XP_010652130.1| PREDICTED: uncharacterized protein LOC104879... 59 2e-06 ref|XP_010255876.1| PREDICTED: uncharacterized protein LOC104596... 59 2e-06 gb|KJB23129.1| hypothetical protein B456_004G082900, partial [Go... 56 8e-06 ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 56 8e-06 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] Length = 45 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/35 (71%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = -3 Query: 462 TKVSSWKRC---LRQQRARLYIIWRCTVILVCWHE 367 +KV SW+RC +RQQR RLYIIWRCTV+L+CWHE Sbjct: 11 SKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] gi|561017798|gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = -3 Query: 462 TKVSSWKRC---LRQQRARLYIIWRCTVILVCWHE 367 +K+ SW+RC +RQQR RLYIIWRCTV+L+CWHE Sbjct: 11 SKIRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_010652130.1| PREDICTED: uncharacterized protein LOC104879778 [Vitis vinifera] Length = 44 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -3 Query: 459 KVSSWKRC---LRQQRARLYIIWRCTVILVCWHE 367 K+ SW+RC +R+QRARLYIIWRCTVIL+CWH+ Sbjct: 11 KLRSWQRCSKHVREQRARLYIIWRCTVILLCWHD 44 >ref|XP_010255876.1| PREDICTED: uncharacterized protein LOC104596423 [Nelumbo nucifera] Length = 47 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/34 (67%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -3 Query: 459 KVSSWKRC---LRQQRARLYIIWRCTVILVCWHE 367 K+ SW+RC +R+QRARLYIIWRCTV+L+CWH+ Sbjct: 14 KLRSWQRCSRHIREQRARLYIIWRCTVMLICWHD 47 >gb|KJB23129.1| hypothetical protein B456_004G082900, partial [Gossypium raimondii] Length = 90 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Frame = -3 Query: 459 KVSSWKRC---LRQQRARLYIIWRCTVILVCWHE 367 K SW+RC +R+QRARLYI+WRCTV+L+CWH+ Sbjct: 57 KGRSWQRCSKQIREQRARLYIVWRCTVLLLCWHD 90 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Frame = -3 Query: 459 KVSSWKRC---LRQQRARLYIIWRCTVILVCWHE 367 K+ SW+RC +R+QR RLYIIWRCTV+L+CWH+ Sbjct: 31 KLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64