BLASTX nr result
ID: Cinnamomum23_contig00034139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00034139 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 107 4e-21 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 107 bits (266), Expect = 4e-21 Identities = 55/73 (75%), Positives = 59/73 (80%), Gaps = 2/73 (2%) Frame = +3 Query: 3 YIEHSFLSIDRKIFVKYRTLPFFFFRNSSYQRQLPTSTPPHTTSWGGAVRLLNQ--GSRG 176 YIEHSFLSIDRKIFVKYRT PFF +NSSY RQL TSTPPHTTSWGG + SRG Sbjct: 6 YIEHSFLSIDRKIFVKYRTFPFF--KNSSYPRQLITSTPPHTTSWGGCSPFESNKVSSRG 63 Query: 177 FIATFILKETEEP 215 FIATF+LKE+EEP Sbjct: 64 FIATFVLKESEEP 76