BLASTX nr result
ID: Cinnamomum23_contig00033999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00033999 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011043997.1| PREDICTED: NAC domain-containing protein 55-... 59 1e-06 >ref|XP_011043997.1| PREDICTED: NAC domain-containing protein 55-like [Populus euphratica] Length = 434 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = -2 Query: 159 EDEWYFFTKA--KQHSGNRVDRRAGDGTWKSGTGATPITNGNRTVGHKTTLTFY 4 E+EWYF T K +G+R +R AGDG WK+ T ITNGN+ +G K TL FY Sbjct: 94 EEEWYFLTPRDRKYPNGDRPNRAAGDGYWKATGADTDITNGNQVIGSKKTLVFY 147