BLASTX nr result
ID: Cinnamomum23_contig00033739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00033739 (675 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68860.1| hypothetical protein VITISV_023024 [Vitis vinifera] 35 9e-06 >emb|CAN68860.1| hypothetical protein VITISV_023024 [Vitis vinifera] Length = 1795 Score = 34.7 bits (78), Expect(4) = 9e-06 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +3 Query: 3 LIEKPKAQRV*NNLRPISFTGCV*KLLSKVLAKRIK*LLPSTIS 134 LI K + + RPIS G V KLL+KVLA R+K ++ IS Sbjct: 1080 LIPKKEGAEDLRDFRPISLVGSVYKLLAKVLANRLKSVMGEVIS 1123 Score = 32.7 bits (73), Expect(4) = 9e-06 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 15/113 (13%) Frame = +1 Query: 214 KGNKQGIL-KIDLE*AYDHVDHLFF*LHARKNGL---------WC-EVEELDLIVSY*ES 360 K N G+L K+D+E A+DHV+ F + G WC ++++ + Sbjct: 1151 KDNVXGLLLKLDIEKAFDHVNWNFLIDVMSRMGFGHKWINWMKWCWSTATFSILINGCPT 1210 Query: 361 EYCKGSTWFWLSDPLHAFLCI-ATDGLRALF*KAKDLGMICGFNV---VRDGL 507 + + S DPL +L + A + L L +A++ G GF V R+GL Sbjct: 1211 GFFRSSRGLRQGDPLSPYLFLFAMEALSQLLSRARNEGFFSGFKVGGRXREGL 1263 Score = 25.0 bits (53), Expect(4) = 9e-06 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 519 IRCEAEMVELQVTKGNFQCSGVMPILRVNLSK 614 I C+A+ V+LQ F + L+VNLSK Sbjct: 1276 IFCDADAVQLQYLSWTFMWFEAISGLKVNLSK 1307 Score = 21.9 bits (45), Expect(4) = 9e-06 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 164 R*ILDVT*VANKQIDSRKETN 226 R ILD +AN+ +DSR + N Sbjct: 1133 RQILDAVLIANEALDSRLKDN 1153