BLASTX nr result
ID: Cinnamomum23_contig00033735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00033735 (262 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010412456.1| PREDICTED: uncharacterized protein LOC104698... 58 3e-06 ref|XP_010424628.1| PREDICTED: uncharacterized protein LOC104709... 57 5e-06 gb|KFK30814.1| hypothetical protein AALP_AA6G029600 [Arabis alpina] 57 5e-06 >ref|XP_010412456.1| PREDICTED: uncharacterized protein LOC104698758 [Camelina sativa] Length = 1103 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 153 VNSSLTTAPILVLPDFSQPFELHCDASKVDIGALLS 260 V LT+APILVLPDF PFELHCDASK+ IGA+LS Sbjct: 654 VKHKLTSAPILVLPDFELPFELHCDASKLGIGAVLS 689 >ref|XP_010424628.1| PREDICTED: uncharacterized protein LOC104709764 [Camelina sativa] Length = 639 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 153 VNSSLTTAPILVLPDFSQPFELHCDASKVDIGALLS 260 + LTTAPILVLPDFS FELHCDASK+ IGA+LS Sbjct: 601 IKLKLTTAPILVLPDFSLTFELHCDASKLGIGAVLS 636 >gb|KFK30814.1| hypothetical protein AALP_AA6G029600 [Arabis alpina] Length = 960 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 153 VNSSLTTAPILVLPDFSQPFELHCDASKVDIGALLS 260 + LTTAPILVLPDF+ FELHCDASK+ IGA+LS Sbjct: 703 IKEKLTTAPILVLPDFNVTFELHCDASKLGIGAILS 738