BLASTX nr result
ID: Cinnamomum23_contig00033307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00033307 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago trunc... 95 2e-17 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 94 5e-17 gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] 91 4e-16 ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phas... 90 7e-16 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 89 2e-15 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 86 7e-15 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 80 4e-13 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 79 9e-13 ref|XP_010227917.1| PREDICTED: uncharacterized protein LOC100843... 72 1e-10 >gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 60 Score = 95.1 bits (235), Expect = 2e-17 Identities = 44/60 (73%), Positives = 54/60 (90%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVKPSP 38 M++FGK V PRQI+L ASGLLFLASTTYDVHRSIKNNE PPS+EQ++AL++Y+ SV+ SP Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRSP 60 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/60 (71%), Positives = 53/60 (88%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVKPSP 38 M++FGK V PRQI+L ASGLLFLASTTYDVHRSIKNNE PPS+EQ++AL++Y+ SV+ P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRQP 60 >gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] Length = 60 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/60 (71%), Positives = 52/60 (86%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVKPSP 38 MK+FGK V P QI+L ASG++FLASTTYDVHRSIKNNE PPSKEQ++AL+DY+ S + SP Sbjct: 1 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKRASP 60 >ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] gi|561015106|gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 89.7 bits (221), Expect = 7e-16 Identities = 41/59 (69%), Positives = 51/59 (86%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVKPS 41 M++FGK V P QI+L ASGLLF ASTTYDVHRSIKNN+ PPS+EQ++ALQDY++S + S Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARRS 59 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/58 (67%), Positives = 51/58 (87%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVKP 44 M+LFGK V PRQIVL A+G++F +TTYDVHRSIKNNE+PP++EQ++ALQDY++S P Sbjct: 687 MRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSKNP 744 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 86.3 bits (212), Expect = 7e-15 Identities = 39/57 (68%), Positives = 50/57 (87%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVK 47 MK+FGK++ RQI + ++G+LF A+TTYDVHRSIKNNE PPS EQIQAL+DY+DSV+ Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVR 57 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/57 (61%), Positives = 48/57 (84%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVK 47 M++ G+ V PRQI L A+GL+F +TTYDVHRSIKNN++PP++EQ+ ALQD++DS K Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRK 57 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 79.3 bits (194), Expect = 9e-13 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDYLDSVK 47 M+L G+ V PRQIVL A+GL+F +TTYDVHRSIKNN++PP+ EQ+ ALQ ++DS K Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRK 57 >ref|XP_010227917.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 119 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/52 (61%), Positives = 43/52 (82%) Frame = -2 Query: 217 MKLFGKKVIPRQIVLAASGLLFLASTTYDVHRSIKNNEKPPSKEQIQALQDY 62 M+ GK V PRQ+ L A+GL+F +TTYDVHRSIKNN++PP++EQ++ALQ Y Sbjct: 1 MRPLGKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52