BLASTX nr result
ID: Cinnamomum23_contig00032709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00032709 (469 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029557.1| Uncharacterized protein TCM_025447 [Theobrom... 62 1e-07 ref|XP_002318771.1| hypothetical protein POPTR_0012s10860g [Popu... 59 1e-06 ref|XP_007027525.1| Uncharacterized protein TCM_022350 [Theobrom... 58 3e-06 >ref|XP_007029557.1| Uncharacterized protein TCM_025447 [Theobroma cacao] gi|508718162|gb|EOY10059.1| Uncharacterized protein TCM_025447 [Theobroma cacao] Length = 314 Score = 62.0 bits (149), Expect = 1e-07 Identities = 35/89 (39%), Positives = 54/89 (60%), Gaps = 1/89 (1%) Frame = -2 Query: 264 PILVFQHGKHDRSQTFFNMSTGSYHARSLRQMHKKDVCLSSHGWLLLRD-LSSRYYFFNP 88 P LV HGK+++ QTFF++S Y+ + + +M K +C SS GWL+L D +S + N Sbjct: 25 PWLVISHGKYNQRQTFFSVSQHRYYTKIIPEMRNKLICGSSFGWLVLVDRVSPNCFLLNL 84 Query: 87 ISLIEIEVPHLTKQHRDWICVLTAPPTAP 1 S+ I++P L + I +LTAPP+ P Sbjct: 85 SSMETIQLPPL--NFKLAIGILTAPPSDP 111 >ref|XP_002318771.1| hypothetical protein POPTR_0012s10860g [Populus trichocarpa] gi|222859444|gb|EEE96991.1| hypothetical protein POPTR_0012s10860g [Populus trichocarpa] Length = 329 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 2/90 (2%) Frame = -2 Query: 264 PILVFQHGKHDRSQTFFNMSTGSYHARSLRQMHKKDVCLSSHGWLLLR--DLSSRYYFFN 91 P LVF HG ++ QTF+++S H +++ + K + S+GWL++ +S + N Sbjct: 25 PCLVFFHGSSEKGQTFYDISECRCHVKNIPGLQGKLIGTCSYGWLVIAGDSISDDCFLLN 84 Query: 90 PISLIEIEVPHLTKQHRDWICVLTAPPTAP 1 PIS +I++P L CVL++PP P Sbjct: 85 PISTKKIQLPSLAPDFTWTDCVLSSPPHRP 114 >ref|XP_007027525.1| Uncharacterized protein TCM_022350 [Theobroma cacao] gi|508716130|gb|EOY08027.1| Uncharacterized protein TCM_022350 [Theobroma cacao] Length = 267 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/86 (34%), Positives = 49/86 (56%) Frame = -2 Query: 264 PILVFQHGKHDRSQTFFNMSTGSYHARSLRQMHKKDVCLSSHGWLLLRDLSSRYYFFNPI 85 P+LV HGK + +TFF++S+ ++ + ++ K +C SS GWL+LR+ S N Sbjct: 27 PLLVISHGKQHQKKTFFSISSDRHYPGIIPEVENKLICTSSFGWLVLREDSHECCVLNLE 86 Query: 84 SLIEIEVPHLTKQHRDWICVLTAPPT 7 S +I++P L C+LTA P+ Sbjct: 87 SREKIQLPALDMNSS--FCILTASPS 110