BLASTX nr result
ID: Cinnamomum23_contig00032699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00032699 (442 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010537516.1| PREDICTED: conserved oligomeric Golgi comple... 77 6e-12 ref|XP_010537515.1| PREDICTED: conserved oligomeric Golgi comple... 77 6e-12 ref|XP_010537514.1| PREDICTED: conserved oligomeric Golgi comple... 77 6e-12 ref|XP_010537513.1| PREDICTED: conserved oligomeric Golgi comple... 77 6e-12 ref|XP_006828628.1| PREDICTED: conserved oligomeric Golgi comple... 77 6e-12 gb|KFK41783.1| hypothetical protein AALP_AA2G171500 [Arabis alpina] 76 1e-11 ref|XP_008345690.1| PREDICTED: conserved oligomeric Golgi comple... 75 2e-11 ref|XP_008242149.1| PREDICTED: conserved oligomeric Golgi comple... 75 2e-11 ref|XP_007204277.1| hypothetical protein PRUPE_ppa001686mg [Prun... 75 2e-11 gb|KDO73747.1| hypothetical protein CISIN_1g0039592mg, partial [... 74 3e-11 gb|KDO73744.1| hypothetical protein CISIN_1g0039592mg, partial [... 74 3e-11 ref|XP_006452908.1| hypothetical protein CICLE_v10007512mg [Citr... 74 3e-11 ref|XP_009359679.1| PREDICTED: conserved oligomeric Golgi comple... 74 4e-11 ref|XP_011461159.1| PREDICTED: conserved oligomeric Golgi comple... 74 5e-11 ref|XP_010471404.1| PREDICTED: conserved oligomeric Golgi comple... 74 5e-11 ref|XP_010428270.1| PREDICTED: conserved oligomeric Golgi comple... 74 5e-11 ref|XP_010428269.1| PREDICTED: conserved oligomeric Golgi comple... 74 5e-11 ref|XP_009106007.1| PREDICTED: conserved oligomeric Golgi comple... 74 5e-11 ref|XP_009106006.1| PREDICTED: conserved oligomeric Golgi comple... 74 5e-11 emb|CDX72989.1| BnaC06g34370D [Brassica napus] 74 5e-11 >ref|XP_010537516.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X4 [Tarenaya hassleriana] Length = 745 Score = 76.6 bits (187), Expect = 6e-12 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +3 Query: 246 NVEIGLNLADLFLIRQLCDL*LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGI 425 +V GL + +++ + LK V EEIESRSSRKEY Q+LSE HRLYCEQRLSLVKGI Sbjct: 236 SVSEGLEASVIYVRFKAAASELKPVLEEIESRSSRKEYVQILSECHRLYCEQRLSLVKGI 295 Query: 426 VQQRI 440 V QRI Sbjct: 296 VHQRI 300 >ref|XP_010537515.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X3 [Tarenaya hassleriana] Length = 782 Score = 76.6 bits (187), Expect = 6e-12 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +3 Query: 246 NVEIGLNLADLFLIRQLCDL*LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGI 425 +V GL + +++ + LK V EEIESRSSRKEY Q+LSE HRLYCEQRLSLVKGI Sbjct: 276 SVSEGLEASVIYVRFKAAASELKPVLEEIESRSSRKEYVQILSECHRLYCEQRLSLVKGI 335 Query: 426 VQQRI 440 V QRI Sbjct: 336 VHQRI 340 >ref|XP_010537514.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X2 [Tarenaya hassleriana] Length = 783 Score = 76.6 bits (187), Expect = 6e-12 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +3 Query: 246 NVEIGLNLADLFLIRQLCDL*LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGI 425 +V GL + +++ + LK V EEIESRSSRKEY Q+LSE HRLYCEQRLSLVKGI Sbjct: 276 SVSEGLEASVIYVRFKAAASELKPVLEEIESRSSRKEYVQILSECHRLYCEQRLSLVKGI 335 Query: 426 VQQRI 440 V QRI Sbjct: 336 VHQRI 340 >ref|XP_010537513.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X1 [Tarenaya hassleriana] Length = 785 Score = 76.6 bits (187), Expect = 6e-12 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = +3 Query: 246 NVEIGLNLADLFLIRQLCDL*LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGI 425 +V GL + +++ + LK V EEIESRSSRKEY Q+LSE HRLYCEQRLSLVKGI Sbjct: 276 SVSEGLEASVIYVRFKAAASELKPVLEEIESRSSRKEYVQILSECHRLYCEQRLSLVKGI 335 Query: 426 VQQRI 440 V QRI Sbjct: 336 VHQRI 340 >ref|XP_006828628.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 [Amborella trichopoda] gi|548833418|gb|ERM96044.1| hypothetical protein AMTR_s00129p00085100 [Amborella trichopoda] Length = 783 Score = 76.6 bits (187), Expect = 6e-12 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK+V EEIESRSSRKEY Q L+E HRLYCEQRLSLVKGIVQQRI Sbjct: 299 LKAVLEEIESRSSRKEYAQALAECHRLYCEQRLSLVKGIVQQRI 342 >gb|KFK41783.1| hypothetical protein AALP_AA2G171500 [Arabis alpina] Length = 781 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY QVL+E HRLYCEQRLSLVKGIVQQR+ Sbjct: 295 LKPVLEEIESRSARKEYVQVLAECHRLYCEQRLSLVKGIVQQRV 338 >ref|XP_008345690.1| PREDICTED: conserved oligomeric Golgi complex subunit 3-like [Malus domestica] Length = 610 Score = 75.1 bits (183), Expect = 2e-11 Identities = 44/87 (50%), Positives = 58/87 (66%) Frame = +3 Query: 180 QVVSDHRTSGRNFIENQYVLN*NVEIGLNLADLFLIRQLCDL*LKSVFEEIESRSSRKEY 359 QV + R+SG N N +V G+ + +++ + LK V EEIESR+SRKEY Sbjct: 262 QVQAAIRSSGGN--------NTSVSEGVEASVIYVRFKAAASELKPVLEEIESRASRKEY 313 Query: 360 TQVLSEYHRLYCEQRLSLVKGIVQQRI 440 TQ+L+E H+LYCEQRLSLV+GIV QRI Sbjct: 314 TQILTECHKLYCEQRLSLVRGIVHQRI 340 >ref|XP_008242149.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 [Prunus mume] Length = 781 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRSSRKEYTQ+L+E H+LYCEQRLSLV+GIV QRI Sbjct: 295 LKPVLEEIESRSSRKEYTQILAECHKLYCEQRLSLVRGIVHQRI 338 >ref|XP_007204277.1| hypothetical protein PRUPE_ppa001686mg [Prunus persica] gi|462399808|gb|EMJ05476.1| hypothetical protein PRUPE_ppa001686mg [Prunus persica] Length = 780 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRSSRKEYTQ+L+E H+LYCEQRLSLV+GIV QRI Sbjct: 295 LKPVLEEIESRSSRKEYTQILAECHKLYCEQRLSLVRGIVHQRI 338 >gb|KDO73747.1| hypothetical protein CISIN_1g0039592mg, partial [Citrus sinensis] Length = 644 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRSS+KEY Q+L E H+LYCEQRLSLVKGIVQQRI Sbjct: 277 LKPVLEEIESRSSKKEYVQILEECHKLYCEQRLSLVKGIVQQRI 320 >gb|KDO73744.1| hypothetical protein CISIN_1g0039592mg, partial [Citrus sinensis] gi|641854951|gb|KDO73745.1| hypothetical protein CISIN_1g0039592mg, partial [Citrus sinensis] gi|641854952|gb|KDO73746.1| hypothetical protein CISIN_1g0039592mg, partial [Citrus sinensis] Length = 665 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRSS+KEY Q+L E H+LYCEQRLSLVKGIVQQRI Sbjct: 298 LKPVLEEIESRSSKKEYVQILEECHKLYCEQRLSLVKGIVQQRI 341 >ref|XP_006452908.1| hypothetical protein CICLE_v10007512mg [Citrus clementina] gi|557556134|gb|ESR66148.1| hypothetical protein CICLE_v10007512mg [Citrus clementina] Length = 783 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRSS+KEY Q+L E H+LYCEQRLSLVKGIVQQRI Sbjct: 298 LKPVLEEIESRSSKKEYVQILEECHKLYCEQRLSLVKGIVQQRI 341 >ref|XP_009359679.1| PREDICTED: conserved oligomeric Golgi complex subunit 3-like [Pyrus x bretschneideri] Length = 777 Score = 73.9 bits (180), Expect = 4e-11 Identities = 44/87 (50%), Positives = 57/87 (65%) Frame = +3 Query: 180 QVVSDHRTSGRNFIENQYVLN*NVEIGLNLADLFLIRQLCDL*LKSVFEEIESRSSRKEY 359 QV + R SG N N +V G+ + +++ + LK V EEIESR+SRKEY Sbjct: 262 QVQAAIRGSGGN--------NASVSEGVEASVIYVRFKAAASELKPVLEEIESRASRKEY 313 Query: 360 TQVLSEYHRLYCEQRLSLVKGIVQQRI 440 TQ+L+E H+LYCEQRLSLV+GIV QRI Sbjct: 314 TQILTECHKLYCEQRLSLVRGIVHQRI 340 >ref|XP_011461159.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X2 [Fragaria vesca subsp. vesca] Length = 778 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESR+SRKEYTQ+L+E H+LYCEQRLSLV+GIV QRI Sbjct: 294 LKPVLEEIESRASRKEYTQILAECHKLYCEQRLSLVRGIVHQRI 337 >ref|XP_010471404.1| PREDICTED: conserved oligomeric Golgi complex subunit 3-like [Camelina sativa] Length = 785 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY Q+L+E HRLYCEQRLSLVKGIV QR+ Sbjct: 299 LKPVLEEIESRSARKEYVQILAECHRLYCEQRLSLVKGIVHQRV 342 >ref|XP_010428270.1| PREDICTED: conserved oligomeric Golgi complex subunit 3-like isoform X2 [Camelina sativa] Length = 680 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY Q+L+E HRLYCEQRLSLVKGIV QR+ Sbjct: 194 LKPVLEEIESRSARKEYVQILAECHRLYCEQRLSLVKGIVHQRV 237 >ref|XP_010428269.1| PREDICTED: conserved oligomeric Golgi complex subunit 3-like isoform X1 [Camelina sativa] Length = 785 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY Q+L+E HRLYCEQRLSLVKGIV QR+ Sbjct: 299 LKPVLEEIESRSARKEYVQILAECHRLYCEQRLSLVKGIVHQRV 342 >ref|XP_009106007.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X2 [Brassica rapa] Length = 680 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY Q+L+E HRLYCEQRLSLVKGIV QR+ Sbjct: 194 LKPVLEEIESRSARKEYVQILAECHRLYCEQRLSLVKGIVHQRV 237 >ref|XP_009106006.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X1 [Brassica rapa] Length = 781 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY Q+L+E HRLYCEQRLSLVKGIV QR+ Sbjct: 295 LKPVLEEIESRSARKEYVQILAECHRLYCEQRLSLVKGIVHQRV 338 >emb|CDX72989.1| BnaC06g34370D [Brassica napus] Length = 794 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 309 LKSVFEEIESRSSRKEYTQVLSEYHRLYCEQRLSLVKGIVQQRI 440 LK V EEIESRS+RKEY Q+L+E HRLYCEQRLSLVKGIV QR+ Sbjct: 305 LKPVLEEIESRSARKEYVQILAECHRLYCEQRLSLVKGIVHQRV 348