BLASTX nr result
ID: Cinnamomum23_contig00032264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00032264 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66059.1| hypothetical protein VITISV_017037 [Vitis vinifera] 64 5e-08 emb|CBI30347.3| unnamed protein product [Vitis vinifera] 63 9e-08 ref|XP_002275884.1| PREDICTED: putative pentatricopeptide repeat... 63 9e-08 ref|XP_010246195.1| PREDICTED: putative pentatricopeptide repeat... 57 5e-06 >emb|CAN66059.1| hypothetical protein VITISV_017037 [Vitis vinifera] Length = 546 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 135 LQHLHAHIVRKGLHQNHILISQLLSLCNSLSETRYSTTIFNHVS 4 L+ +HA I+RKGLHQ+H LISQ L+LCNSLS Y+T++FN VS Sbjct: 41 LEQVHARIIRKGLHQDHFLISQFLTLCNSLSNFSYTTSVFNGVS 84 >emb|CBI30347.3| unnamed protein product [Vitis vinifera] Length = 560 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 135 LQHLHAHIVRKGLHQNHILISQLLSLCNSLSETRYSTTIFNHVS 4 L+ +HA I+RKGLHQ+H +ISQ L+LCNSLS Y+T++FN VS Sbjct: 89 LEQVHARIIRKGLHQDHFIISQFLTLCNSLSNFSYTTSVFNGVS 132 >ref|XP_002275884.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Vitis vinifera] Length = 561 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 135 LQHLHAHIVRKGLHQNHILISQLLSLCNSLSETRYSTTIFNHVS 4 L+ +HA I+RKGLHQ+H +ISQ L+LCNSLS Y+T++FN VS Sbjct: 41 LEQVHARIIRKGLHQDHFIISQFLTLCNSLSNFSYTTSVFNGVS 84 >ref|XP_010246195.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Nelumbo nucifera] Length = 561 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = -2 Query: 141 RHLQHLHAHIVRKGLHQNHILISQLLSLCNSLSETRYSTTIFNHVS 4 R+L+ +HA IV+KG+ Q++ LI+Q + LCNS S RY+T++FN VS Sbjct: 39 RNLEQVHAQIVQKGVEQDNFLINQFICLCNSFSNIRYATSVFNRVS 84